F286422

General Info

Members Datasets Scaffolds Average Seq Length
186 132 372 173

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0791624|Ga0466966_0791624_13_531
Length 172
Sequence VRIVAGKFAGRDLTSPNDFRVRPTAEHVRAAVLDLLGAEVKDARVLDLFAGTGALGLEAISRGARSADFVETRPASLHALRANIAALRGVRERTRIFKRDALPFAAALPAGAYDLAFVDPPYGSRMLDRVIETWQASGFARVLAVEHAATHELPAGAVRRTLEETAITIYRA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
131 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
132 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 1.61
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0791624 3300044684 Bacteria 572
2 Ga0070658_10006951 3300005327 Bacteria 9143
3 Ga0070658_10061209 3300005327 Bacteria 3067
4 Ga0070658_10093826 3300005327 Bacteria 2475
5 Ga0070658_10246849 3300005327 Bacteria 1514
6 Ga0070658_11160416 3300005327 Bacteria 672
7 Ga0070683_100046246 3300005329 Bacteria 4020
8 Ga0070683_100494944 3300005329 Bacteria 1168
9 Ga0070687_100903652 3300005343 Bacteria 633
10 Ga0070661_100026853 3300005344 Bacteria 4143
11 Ga0070661_100034433 3300005344 Bacteria 3672
12 Ga0070692_10322897 3300005345 Unclassified 950
13 Ga0070668_100007926 3300005347 Bacteria 7886
14 Ga0070668_100107850 3300005347 Bacteria 2214
15 Ga0070671_100058560 3300005355 Bacteria 3207
16 Ga0070674_100291277 3300005356 Bacteria 1298
17 Ga0070674_100389996 3300005356 Bacteria 1135
18 Ga0070688_100920570 3300005365 Unclassified 690
19 Ga0070667_100460571 3300005367 Bacteria 1163
20 Ga0070714_100072641 3300005435 Bacteria 2979
21 Ga0070714_101123402 3300005435 Bacteria 766
22 Ga0070710_10488498 3300005437 Bacteria 841
23 Ga0070701_10213471 3300005438 Bacteria 1147
24 Ga0070700_100198775 3300005441 Unclassified 1407
25 Ga0070662_100000383 3300005457 Bacteria 26286
26 Ga0070681_10015932 3300005458 Bacteria 7496
27 Ga0070681_10235973 3300005458 Bacteria 1743
28 Ga0070685_10000817 3300005466 Bacteria 16911
29 Ga0070685_10003808 3300005466 Bacteria 7630
30 Ga0070706_100017893 3300005467 Bacteria 6539
31 Ga0070698_100000213 3300005471 Bacteria 56531
32 Ga0070699_100074582 3300005518 Bacteria 2952
33 Ga0070699_100583136 3300005518 Bacteria 1019
34 Ga0070679_100078538 3300005530 Bacteria 3289
35 Ga0070684_100189582 3300005535 Bacteria 1870
36 Ga0070672_100237938 3300005543 Bacteria 1531
37 Ga0070672_100271251 3300005543 Unclassified 1433
38 Ga0070672_100667591 3300005543 Bacteria 909
39 Ga0070672_100695700 3300005543 Bacteria 890
40 Ga0070686_100000115 3300005544 Bacteria 56237
41 Ga0070664_100111228 3300005564 Bacteria 2391
42 Ga0070664_100127561 3300005564 Bacteria 2233
43 Ga0070664_100192808 3300005564 Bacteria 1816
44 Ga0068856_100475900 3300005614 Bacteria 1270
45 Ga0068852_101357372 3300005616 Unclassified 733
46 Ga0068859_100392871 3300005617 Archaea 1483
47 Ga0068861_101392015 3300005719 Bacteria 685
48 Ga0068851_10071657 3300005834 Bacteria 1794
49 Ga0068858_100268719 3300005842 Bacteria 1622
50 Ga0068860_100093692 3300005843 Bacteria 2863
51 Ga0075428_100577583 3300006844 Bacteria 1201
52 Ga0075428_102127935 3300006844 Bacteria 580
53 Ga0075431_100265968 3300006847 Bacteria 1739
54 Ga0068865_100009272 3300006881 Bacteria 6096
55 Ga0068865_100372193 3300006881 Bacteria 1163
56 Ga0097620_100392834 3300006931 Archaea 1483
57 Ga0111539_10081694 3300009094 Bacteria 3801
58 Ga0111539_10246232 3300009094 Unclassified 2081
59 Ga0114129_10230713 3300009147 Bacteria 2493
60 Ga0105242_10048767 3300009176 Bacteria 3443
61 Ga0105248_10017614 3300009177 Bacteria 7880
62 Ga0105248_10762991 3300009177 Bacteria 1091
63 Ga0105238_10000165 3300009551 Bacteria 71706
64 Ga0157371_10059349 3300013102 Bacteria 2712
65 Ga0157374_10808349 3300013296 Bacteria 953
66 Ga0157378_11451809 3300013297 Bacteria 730
67 Ga0157372_10033799 3300013307 Bacteria 5619
68 Ga0157372_10949722 3300013307 Bacteria 997
69 Ga0157372_11104442 3300013307 Bacteria 917
70 Ga0157375_10020864 3300013308 Bacteria 5996
71 Ga0157375_10743827 3300013308 Bacteria 1132
72 Ga0157380_10254099 3300014326 Unclassified 1592
73 Ga0157377_10102885 3300014745 Bacteria 1705
74 Ga0163161_10140085 3300017792 Bacteria 1831
75 Ga0163161_10208862 3300017792 Bacteria 1507
76 Ga0206353_10635569 3300020082 Bacteria 964
77 Ga0213876_10004352 3300021384 Bacteria 7933
78 Ga0207645_10278442 3300025907 Bacteria 1110
79 Ga0207705_10007163 3300025909 Bacteria 8215
80 Ga0207705_10127110 3300025909 Bacteria 1895
81 Ga0207705_10317954 3300025909 Bacteria 1196
82 Ga0207705_10474775 3300025909 Bacteria 971
83 Ga0207684_10041522 3300025910 Bacteria 3900
84 Ga0207707_10052994 3300025912 Bacteria 3531
85 Ga0207662_10050463 3300025918 Bacteria 2472
86 Ga0207662_10140537 3300025918 Bacteria 1529
87 Ga0207662_10239776 3300025918 Bacteria 1187
88 Ga0207662_10403299 3300025918 Bacteria 927
89 Ga0207649_10331881 3300025920 Bacteria 1120
90 Ga0207652_10449380 3300025921 Bacteria 1162
91 Ga0207681_10136894 3300025923 Unclassified 1819
92 Ga0207694_10000091 3300025924 Bacteria 101725
93 Ga0207659_10608264 3300025926 Unclassified 932
94 Ga0207664_10052512 3300025929 Bacteria 3224
95 Ga0207664_10496485 3300025929 Bacteria 1093
96 Ga0207644_10403697 3300025931 Bacteria 1117
97 Ga0207706_10000777 3300025933 Bacteria 33046
98 Ga0207686_10271666 3300025934 Bacteria 1247
99 Ga0207709_10346968 3300025935 Bacteria 1119
100 Ga0207670_10612516 3300025936 Bacteria 895
101 Ga0207691_10102158 3300025940 Bacteria 2558
102 Ga0207691_10202033 3300025940 Bacteria 1729
103 Ga0207691_10598251 3300025940 Bacteria 934
104 Ga0207711_10033947 3300025941 Bacteria 4319
105 Ga0207711_10634578 3300025941 Bacteria 997
106 Ga0207661_10126385 3300025944 Bacteria 2184
107 Ga0207661_10312923 3300025944 Bacteria 1410
108 Ga0207679_10141271 3300025945 Bacteria 1947
109 Ga0207679_10223318 3300025945 Bacteria 1586
110 Ga0207679_10291849 3300025945 Bacteria 1402
111 Ga0207667_10391042 3300025949 Bacteria 1416
112 Ga0207651_10099608 3300025960 Bacteria 2153
113 Ga0207651_11381576 3300025960 Bacteria 634
114 Ga0207668_10014787 3300025972 Bacteria 4837
115 Ga0207703_10151685 3300026035 Bacteria 2021
116 Ga0207708_10115087 3300026075 Bacteria 2091
117 Ga0207676_10195688 3300026095 Bacteria 1783
118 Ga0207674_10030615 3300026116 Bacteria 5657
119 Ga0207674_10320881 3300026116 Bacteria 1498
120 Ga0207675_101605223 3300026118 Bacteria 671
121 Ga0207683_10497775 3300026121 Bacteria 1125
122 Ga0207698_10003502 3300026142 Bacteria 9463
123 Ga0207698_10010516 3300026142 Bacteria 5953
124 Ga0268265_10313408 3300028380 Unclassified 1418
125 Ga0268264_10355570 3300028381 Bacteria 1395
126 Ga0265314_10019111 3300031711 Bacteria 5317
127 Ga0265342_10278653 3300031712 Bacteria 885
128 Ga0307405_10384707 3300031731 Bacteria 1093
129 Ga0307405_10754816 3300031731 Bacteria 811
130 Ga0307413_10305757 3300031824 Bacteria 1208
131 Ga0307407_10394740 3300031903 Bacteria 991
132 Ga0307407_10591093 3300031903 Bacteria 825
133 Ga0307412_10120779 3300031911 Bacteria 1886
134 Ga0307414_10559098 3300032004 Bacteria 1021
135 Ga0307414_10575850 3300032004 Bacteria 1007
136 Ga0307415_100344273 3300032126 Bacteria 1252
137 Ga0307415_100351230 3300032126 Bacteria 1241
138 Ga0373959_0000016 3300034820 Bacteria 42834
139 Ga0373955_0498243 3300035172 Bacteria 744
140 Ga0395899_0066116 3300037312 Bacteria 2655
141 Ga0395899_0091231 3300037312 Bacteria 2208
142 Ga0395900_0162427 3300037418 Bacteria 2278
143 Ga0395898_0083233 3300037466 Bacteria 3084
144 Ga0395905_0027183 3300037471 Bacteria 5396
145 Ga0395905_0093920 3300037471 Bacteria 2813
146 Ga0395905_0707590 3300037471 Unclassified 910
147 Ga0395905_0984862 3300037471 Bacteria 746
148 Ga0395901_0001590 3300038443 Bacteria 23498
149 Ga0395901_0140266 3300038443 Bacteria 2540
150 Ga0436365_1498085 3300039437 Bacteria 9051
151 Ga0451577_0000464 3300042876 Bacteria 70317
152 Ga0451577_0010620 3300042876 Bacteria 8779
153 Ga0451577_0209573 3300042876 Bacteria 1760
154 Ga0466961_0113046 3300044693 Bacteria 1707
155 Ga0453684_0000351 3300044712 Bacteria 191794
156 Ga0466960_0677587 3300044901 Bacteria 617
157 Ga0466967_0640268 3300045976 Bacteria 1051
158 Ga0495596_0098857 3300046500 Bacteria 1133
159 Ga0495643_0000045 3300046522 Bacteria 224043
160 Ga0495621_0054263 3300046539 Bacteria 1440
161 Ga0495621_0324929 3300046539 Bacteria 641
162 Ga0495667_0062909 3300046559 Bacteria 2431
163 Ga0495656_0080749 3300046615 Bacteria 1467
164 Ga0495634_0281468 3300046642 Unclassified 1010
165 Ga0495623_0035087 3300046679 Bacteria 3215
166 Ga0495613_0013275 3300046689 Bacteria 6121
167 Ga0495600_0209656 3300046809 Bacteria 1249
168 Ga0495675_0077252 3300047444 Bacteria 2098
169 Ga0496100_0168381 3300048903 Bacteria 1576
170 Ga0496101_0135750 3300048904 Bacteria 1872
171 Ga0496115_0097322 3300048918 Bacteria 2410
172 Ga0501299_026703 3300049522 Bacteria 1092
173 Ga0501032_0144696 3300049569 Bacteria 1565
174 Ga0501034_0232315 3300049571 Bacteria 1793
175 Ga0501037_0449421 3300049573 Bacteria 879
176 Ga0501038_0116406 3300049574 Bacteria 2209
177 Ga0501047_0328809 3300049581 Bacteria 1367
178 Ga0501035_0382007 3300049822 Bacteria 1174
179 Ga0501044_0500940 3300049823 Bacteria 1116
180 nmdc:mga0qj67_715924_c1 3300050509 Bacteria 796
181 nmdc:mga06r32_604743_c1 3300050510 Bacteria 1067
182 nmdc:mga08y16_1117601_c1 3300050511 Bacteria 762
183 nmdc:mga08y16_173160_c1 3300050511 Bacteria 2241
184 Ga0500554_170113 3300053102 Bacteria 734
185 Ga0500628_001544 3300053129 Bacteria 3916
186 Ga0500596_057967 3300053735 Bacteria 644
187 Ga0466966_0791624
188 Ga0070658_10006951
189 Ga0070658_10061209
190 Ga0070658_10093826
191 Ga0070658_10246849
192 Ga0070658_11160416
193 Ga0070683_100046246
194 Ga0070683_100494944
195 Ga0070687_100903652
196 Ga0070661_100026853
197 Ga0070661_100034433
198 Ga0070692_10322897
199 Ga0070668_100007926
200 Ga0070668_100107850
201 Ga0070671_100058560
202 Ga0070674_100291277
203 Ga0070674_100389996
204 Ga0070688_100920570
205 Ga0070667_100460571
206 Ga0070714_100072641
207 Ga0070714_101123402
208 Ga0070710_10488498
209 Ga0070701_10213471
210 Ga0070700_100198775
211 Ga0070662_100000383
212 Ga0070681_10015932
213 Ga0070681_10235973
214 Ga0070685_10000817
215 Ga0070685_10003808
216 Ga0070706_100017893
217 Ga0070698_100000213
218 Ga0070699_100074582
219 Ga0070699_100583136
220 Ga0070679_100078538
221 Ga0070684_100189582
222 Ga0070672_100237938
223 Ga0070672_100271251
224 Ga0070672_100667591
225 Ga0070672_100695700
226 Ga0070686_100000115
227 Ga0070664_100111228
228 Ga0070664_100127561
229 Ga0070664_100192808
230 Ga0068856_100475900
231 Ga0068852_101357372
232 Ga0068859_100392871
233 Ga0068861_101392015
234 Ga0068851_10071657
235 Ga0068858_100268719
236 Ga0068860_100093692
237 Ga0075428_100577583
238 Ga0075428_102127935
239 Ga0075431_100265968
240 Ga0068865_100009272
241 Ga0068865_100372193
242 Ga0097620_100392834
243 Ga0111539_10081694
244 Ga0111539_10246232
245 Ga0114129_10230713
246 Ga0105242_10048767
247 Ga0105248_10017614
248 Ga0105248_10762991
249 Ga0105238_10000165
250 Ga0157371_10059349
251 Ga0157374_10808349
252 Ga0157378_11451809
253 Ga0157372_10033799
254 Ga0157372_10949722
255 Ga0157372_11104442
256 Ga0157375_10020864
257 Ga0157375_10743827
258 Ga0157380_10254099
259 Ga0157377_10102885
260 Ga0163161_10140085
261 Ga0163161_10208862
262 Ga0206353_10635569
263 Ga0213876_10004352
264 Ga0207645_10278442
265 Ga0207705_10007163
266 Ga0207705_10127110
267 Ga0207705_10317954
268 Ga0207705_10474775
269 Ga0207684_10041522
270 Ga0207707_10052994
271 Ga0207662_10050463
272 Ga0207662_10140537
273 Ga0207662_10239776
274 Ga0207662_10403299
275 Ga0207649_10331881
276 Ga0207652_10449380
277 Ga0207681_10136894
278 Ga0207694_10000091
279 Ga0207659_10608264
280 Ga0207664_10052512
281 Ga0207664_10496485
282 Ga0207644_10403697
283 Ga0207706_10000777
284 Ga0207686_10271666
285 Ga0207709_10346968
286 Ga0207670_10612516
287 Ga0207691_10102158
288 Ga0207691_10202033
289 Ga0207691_10598251
290 Ga0207711_10033947
291 Ga0207711_10634578
292 Ga0207661_10126385
293 Ga0207661_10312923
294 Ga0207679_10141271
295 Ga0207679_10223318
296 Ga0207679_10291849
297 Ga0207667_10391042
298 Ga0207651_10099608
299 Ga0207651_11381576
300 Ga0207668_10014787
301 Ga0207703_10151685
302 Ga0207708_10115087
303 Ga0207676_10195688
304 Ga0207674_10030615
305 Ga0207674_10320881
306 Ga0207675_101605223
307 Ga0207683_10497775
308 Ga0207698_10003502
309 Ga0207698_10010516
310 Ga0268265_10313408
311 Ga0268264_10355570
312 Ga0265314_10019111
313 Ga0265342_10278653
314 Ga0307405_10384707
315 Ga0307405_10754816
316 Ga0307413_10305757
317 Ga0307407_10394740
318 Ga0307407_10591093
319 Ga0307412_10120779
320 Ga0307414_10559098
321 Ga0307414_10575850
322 Ga0307415_100344273
323 Ga0307415_100351230
324 Ga0373959_0000016
325 Ga0373955_0498243
326 Ga0395899_0066116
327 Ga0395899_0091231
328 Ga0395900_0162427
329 Ga0395898_0083233
330 Ga0395905_0027183
331 Ga0395905_0093920
332 Ga0395905_0707590
333 Ga0395905_0984862
334 Ga0395901_0001590
335 Ga0395901_0140266
336 Ga0436365_1498085
337 Ga0451577_0000464
338 Ga0451577_0010620
339 Ga0451577_0209573
340 Ga0466961_0113046
341 Ga0453684_0000351
342 Ga0466960_0677587
343 Ga0466967_0640268
344 Ga0495596_0098857
345 Ga0495643_0000045
346 Ga0495621_0054263
347 Ga0495621_0324929
348 Ga0495667_0062909
349 Ga0495656_0080749
350 Ga0495634_0281468
351 Ga0495623_0035087
352 Ga0495613_0013275
353 Ga0495600_0209656
354 Ga0495675_0077252
355 Ga0496100_0168381
356 Ga0496101_0135750
357 Ga0496115_0097322
358 Ga0501299_026703
359 Ga0501032_0144696
360 Ga0501034_0232315
361 Ga0501037_0449421
362 Ga0501038_0116406
363 Ga0501047_0328809
364 Ga0501035_0382007
365 Ga0501044_0500940
366 nmdc:mga0qj67_715924_c1
367 nmdc:mga06r32_604743_c1
368 nmdc:mga08y16_1117601_c1
369 nmdc:mga08y16_173160_c1
370 Ga0500554_170113
371 Ga0500628_001544
372 Ga0500596_057967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

166

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8978 29 169
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.8869 1 169
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8796 1 168
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8715 1 168
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8713 1 169
ID Description Score Start End Superfamily
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9144 1 170 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9081 1 169 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8909 3 169 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8884 39 103 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8847 1 170 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0S8AML1-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9843 1 169 GO:0008168
GO:0031167
AF-A0A2V7H8Q1-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9795 1 103 GO:0008168
GO:0031167
AF-A0A1W9RIL7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9713 1 85 GO:0008168
GO:0031167
AF-A0A530L653-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9712 32 100 GO:0008168
GO:0031167
AF-A0A3D5JDS1-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9668 1 104 GO:0008168
GO:0031167

Map