F286134

General Info

Members Datasets Scaffolds Average Seq Length
186 140 173 275

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10109661|Ga0207704_101096612
Length 304
Sequence LIIVFSIHKLLCTFQFIFDRSKIVDQTSAYMKKLLVLFLITSFFTSFKKKEITWTAIGDSITYLNDHPNETGNRISKGYMTMVKEALPDIHFINQGHNGWTSGRIATNIEKLGLLKSDVYSVFLGTNDWWHADTLGNFTDYKNNTGSKTLYGSYRIIIDKIRSLNKKAKIILITPMQRADFVYISNPKNNAYGSYRPKSGFTLEQFAAAIDSIGHFEHCKVVDLYHKKELAVNFLVKYKRLKDPKTGSYKNYSYPDFIDIPFNPETDEYPYPADAIDITYDGLHPSDKGYEIIANMLIKIMKKY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
92 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
120 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
121 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
122 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
125 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
126 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
131 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
132 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 0
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2468263 2162886007 Bacteria 2596
2 SwRhRL2b_contig_2664430 2162886007 Bacteria 22056
3 JGI24735J21928_10000002 3300002067 Bacteria 624895
4 rootH1_10025824 3300003316 Bacteria 4185
5 rootH2_10213590 3300003320 Bacteria 1868
6 rootL2_10312454 3300003322 Bacteria 1815
7 rootL2_10338882 3300003322 Bacteria 1223
8 rootL2_10386274 3300003322 Bacteria 1209
9 Ga0055531_10000263 3300003794 Bacteria 55230
10 Ga0065165_1025739 3300005262 Bacteria 1949
11 Ga0065714_10002226 3300005288 Bacteria 54034
12 Ga0065714_10009356 3300005288 Bacteria 11773
13 Ga0065704_10070203 3300005289 Bacteria 85863
14 Ga0065704_10073630 3300005289 Bacteria 6941
15 Ga0065712_10084129 3300005290 Bacteria 2774
16 Ga0065712_10118156 3300005290 Bacteria 1710
17 Ga0070670_100379996 3300005331 Bacteria 1244
18 Ga0068869_100298797 3300005334 Bacteria 1299
19 Ga0070687_100059605 3300005343 Bacteria 2010
20 Ga0070668_100076236 3300005347 Bacteria 2619
21 Ga0070669_100234289 3300005353 Bacteria 1456
22 Ga0070675_100034072 3300005354 Bacteria 4131
23 Ga0070688_100012583 3300005365 Bacteria 4744
24 Ga0070667_100225266 3300005367 Bacteria 1670
25 Ga0070701_10028334 3300005438 Bacteria 2753
26 Ga0068867_100215609 3300005459 Bacteria 1544
27 Ga0070685_10037144 3300005466 Bacteria 2757
28 Ga0070685_10148688 3300005466 Bacteria 1482
29 Ga0068853_100006656 3300005539 Bacteria 9202
30 Ga0068853_100542738 3300005539 Bacteria 1101
31 Ga0068855_100065679 3300005563 Bacteria 4230
32 Ga0068857_100240883 3300005577 Bacteria 1656
33 Ga0068857_100558218 3300005577 Bacteria 1079
34 Ga0068856_100633107 3300005614 Bacteria 1090
35 Ga0068852_100114841 3300005616 Bacteria 2454
36 Ga0068859_100000646 3300005617 Bacteria 34856
37 Ga0068864_100014569 3300005618 Bacteria 6533
38 Ga0068851_10161580 3300005834 Bacteria 1231
39 Ga0068863_100011408 3300005841 Bacteria 8597
40 Ga0068863_100325111 3300005841 Bacteria 1494
41 Ga0068858_100390336 3300005842 Bacteria 1336
42 Ga0068860_100008515 3300005843 Bacteria 10218
43 Ga0081455_10108976 3300005937 Bacteria 2204
44 Ga0068871_100017691 3300006358 Bacteria 5400
45 Ga0075428_100101125 3300006844 Bacteria 3143
46 Ga0097620_100000646 3300006931 Bacteria 34856
47 Ga0105240_10001289 3300009093 Bacteria 43373
48 Ga0105240_10034239 3300009093 Bacteria 6555
49 Ga0105240_10075431 3300009093 Bacteria 4159
50 Ga0111539_10049264 3300009094 Bacteria 5025
51 Ga0111539_10090595 3300009094 Bacteria 3594
52 Ga0105241_10049347 3300009174 Bacteria 3205
53 Ga0105237_10005717 3300009545 Bacteria 13978
54 Ga0105237_10026451 3300009545 Bacteria 5930
55 Ga0105237_10030153 3300009545 Bacteria 5511
56 Ga0105237_10034436 3300009545 Bacteria 5128
57 Ga0105237_10144295 3300009545 Unclassified 2375
58 Ga0105238_10176269 3300009551 Bacteria 2115
59 Ga0105249_10163125 3300009553 Unclassified 2155
60 Ga0105249_10183155 3300009553 Bacteria 2039
61 Ga0105249_10253742 3300009553 Bacteria 1745
62 Ga0105239_10002110 3300010375 Bacteria 25672
63 Ga0105239_10003353 3300010375 Bacteria 19678
64 Ga0157373_10000074 3300013100 Bacteria 86431
65 Ga0157373_10004906 3300013100 Bacteria 10074
66 Ga0157371_10001093 3300013102 Bacteria 29401
67 Ga0157371_10002143 3300013102 Bacteria 19239
68 Ga0157370_10004262 3300013104 Bacteria 16506
69 Ga0157370_10191497 3300013104 Bacteria 1898
70 Ga0157378_10294974 3300013297 Bacteria 1567
71 Ga0163162_10089517 3300013306 Bacteria 3159
72 Ga0157372_10004138 3300013307 Bacteria 15533
73 Ga0157372_10017898 3300013307 Bacteria 7614
74 Ga0157372_10331355 3300013307 Unclassified 1773
75 Ga0163163_10142855 3300014325 Bacteria 2436
76 Ga0157380_10374169 3300014326 Bacteria 1342
77 Ga0182006_1002231 3300015261 Bacteria 10725
78 Ga0182005_1000376 3300015265 Bacteria 24665
79 Ga0183373_1005 3300015682 Bacteria 351562
80 Ga0209436_103300 3300025208 Bacteria 4355
81 Ga0209257_1000025 3300025304 Bacteria 724838
82 Ga0207656_10049527 3300025321 Bacteria 1812
83 Ga0207695_10000361 3300025913 Bacteria 104230
84 Ga0207695_10018473 3300025913 Bacteria 8062
85 Ga0207695_10093385 3300025913 Bacteria 3018
86 Ga0207671_10089064 3300025914 Bacteria 2322
87 Ga0207671_10296802 3300025914 Bacteria 1276
88 Ga0207662_10029761 3300025918 Bacteria 3166
89 Ga0207681_10197280 3300025923 Unclassified 1544
90 Ga0207686_10000459 3300025934 Bacteria 27073
91 Ga0207670_10007595 3300025936 Bacteria 6062
92 Ga0207670_10102481 3300025936 Bacteria 2047
93 Ga0207670_10395115 3300025936 Bacteria 1104
94 Ga0207704_10109661 3300025938 Bacteria 1862
95 Ga0207689_10037648 3300025942 Bacteria 4011
96 Ga0207667_10073720 3300025949 Bacteria 3547
97 Ga0207667_10087890 3300025949 Bacteria 3215
98 Ga0207667_10665838 3300025949 Bacteria 1045
99 Ga0207651_10038090 3300025960 Bacteria 3156
100 Ga0207712_10139902 3300025961 Bacteria 1856
101 Ga0207712_10580375 3300025961 Bacteria 967
102 Ga0207658_10221005 3300025986 Bacteria 1594
103 Ga0207639_10541343 3300026041 Unclassified 1068
104 Ga0207702_10059616 3300026078 Bacteria 3251
105 Ga0207641_10002576 3300026088 Bacteria 16662
106 Ga0207641_10304005 3300026088 Bacteria 1507
107 Ga0207676_10082420 3300026095 Bacteria 2616
108 Ga0207676_10155046 3300026095 Bacteria 1977
109 Ga0207674_10579561 3300026116 Bacteria 1084
110 Ga0207675_100208052 3300026118 Bacteria 1881
111 Ga0268265_10054635 3300028380 Bacteria 3032
112 Ga0268264_10122380 3300028381 Unclassified 2295
113 Ga0268264_10184222 3300028381 Bacteria 1899
114 Ga0316177_1219627 3300030731 Bacteria 14884
115 Ga0316176_1020647 3300030732 Bacteria 21813
116 Ga0316183_1166136 3300030742 Bacteria 44041
117 Ga0316181_1042481 3300030744 Bacteria 16423
118 Ga0265327_10000164 3300031251 Bacteria 143027
119 Ga0265327_10000415 3300031251 Bacteria 78296
120 Ga0265327_10055185 3300031251 Bacteria 2053
121 Ga0307412_10000038 3300031911 Bacteria 187857
122 Ga0307414_10016110 3300032004 Bacteria 4534
123 Ga0373935_0099956 3300035692 Bacteria 1911
124 Ga0453683_0000143 3300044673 Bacteria 104632
125 Ga0453683_0144759 3300044673 Unclassified 1500
126 Ga0453684_0045816 3300044712 Bacteria 5828
127 Ga0453684_0108012 3300044712 Bacteria 3387
128 Ga0466957_0023367 3300044842 Bacteria 3655
129 Ga0451576_0054780 3300045051 Bacteria 4174
130 Ga0451576_0324446 3300045051 Bacteria 1611
131 Ga0495629_0034111 3300046459 Bacteria 3598
132 Ga0495664_0106849 3300046477 Bacteria 1688
133 Ga0495621_0019217 3300046539 Unclassified 2229
134 Ga0495635_0317038 3300046663 Bacteria 1044
135 Ga0495658_0261981 3300046683 Unclassified 1088
136 Ga0495686_0121777 3300047472 Bacteria 1554
137 Ga0495686_0131779 3300047472 Unclassified 1481
138 Ga0496121_0000028 3300048924 Bacteria 439193
139 Ga0496126_0006279 3300048929 Bacteria 13270
140 Ga0501032_0054543 3300049569 Bacteria 2690
141 Ga0501033_0082329 3300049570 Bacteria 2360
142 Ga0501034_0041203 3300049571 Bacteria 4672
143 Ga0501038_0038950 3300049574 Bacteria 4160
144 Ga0501043_0106510 3300049579 Bacteria 2202
145 Ga0501043_0367881 3300049579 Unclassified 1090
146 Ga0501047_0131869 3300049581 Bacteria 2379
147 Ga0501048_0385728 3300049582 Unclassified 1001
148 Ga0501202_005410 3300049652 Bacteria 2261
149 Ga0501208_019386 3300049655 Bacteria 1095
150 Ga0501217_000029 3300049661 Bacteria 15673
151 Ga0501222_001152 3300049662 Bacteria 3743
152 Ga0501223_007428 3300049663 Bacteria 2244
153 Ga0501235_000557 3300049669 Bacteria 7477
154 Ga0501242_000227 3300049674 Bacteria 4414
155 Ga0501243_004917 3300049675 Bacteria 2005
156 Ga0501243_006975 3300049675 Bacteria 1722
157 Ga0501248_004081 3300049678 Bacteria 1085
158 Ga0501259_006328 3300049688 Bacteria 1883
159 Ga0501261_003107 3300049690 Bacteria 2039
160 Ga0501261_004888 3300049690 Bacteria 1671
161 Ga0501225_0002007 3300049705 Bacteria 6337
162 Ga0501271_001902 3300049768 Bacteria 1820
163 Ga0501281_03674 3300049777 Bacteria 1093
164 Ga0501283_004598 3300049779 Bacteria 1872
165 Ga0501035_0076756 3300049822 Bacteria 2954
166 Ga0501044_0150120 3300049823 Bacteria 2313
167 nmdc:mga0k408_66864_c1 3300050493 Bacteria 2094
168 nmdc:mga05p37_4327_c1 3300050507 Bacteria 16592
169 nmdc:mga08y16_30843_c1 3300050511 Bacteria 5638
170 nmdc:mga08y16_32321_c2 3300050511 Bacteria 4883
171 Ga0500651_0000145 3300053093 Bacteria 44863
172 Ga0500559_0013943 3300053136 Bacteria 3397
173 Ga0500622_0006380 3300053156 Bacteria 6861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10001289 Ga0105240_1000128916 245
2 3300025913 Ga0207695_10000361 Ga0207695_1000036122 245
3 3300009545 Ga0105237_10026451 Ga0105237_100264512 246
4 3300025914 Ga0207671_10296802 Ga0207671_102968022 246
5 3300009094 Ga0111539_10090595 Ga0111539_100905951 249
6 3300009551 Ga0105238_10176269 Ga0105238_101762692 250
7 3300006844 Ga0075428_100101125 Ga0075428_1001011252 251
8 3300050511 nmdc:mga08y16_32321_c2 nmdc:mga08y16_32321_c2_42_869 251
9 3300048924 Ga0496121_0000028 Ga0496121_0000028_68883_69674 258
10 3300009094 Ga0111539_10049264 Ga0111539_100492641 259
11 3300015265 Ga0182005_1000376 Ga0182005_10003768 262
12 3300044842 Ga0466957_0023367 Ga0466957_0023367_1156_2025 262
13 3300047472 Ga0495686_0121777 Ga0495686_0121777_438_1259 264
14 3300050493 nmdc:mga0k408_66864_c1 nmdc:mga0k408_66864_c1_481_1302 264
15 3300044673 Ga0453683_0144759 Ga0453683_0144759_115_939 265
16 3300013100 Ga0157373_10004906 Ga0157373_100049063 266
17 3300005262 Ga0065165_1025739 Ga0065165_10257391 267
18 3300025208 Ga0209436_103300 Ga0209436_1033004 267
19 3300005331 Ga0070670_100379996 Ga0070670_1003799961 268
20 3300005539 Ga0068853_100006656 Ga0068853_1000066565 269
21 3300047472 Ga0495686_0131779 Ga0495686_0131779_450_1271 269
22 3300049582 Ga0501048_0385728 Ga0501048_0385728_116_937 269
23 3300053156 Ga0500622_0006380 Ga0500622_0006380_4344_5165 269
24 iso_pu_bacteria 2738543023 2739300264 269
25 iso_pu_bacteria 2883068021 2883071563 269
26 2162886007 SwRhRL2b_contig_2664430 SwRhRL2b_0755.00004240 270
27 3300003322 rootL2_10338882 rootL2_103388821 270
28 3300003322 rootL2_10386274 rootL2_103862742 270
29 3300005288 Ga0065714_10002226 Ga0065714_1000222617 270
30 3300005288 Ga0065714_10009356 Ga0065714_100093566 270
31 3300005289 Ga0065704_10070203 Ga0065704_1007020315 270
32 3300005290 Ga0065712_10084129 Ga0065712_100841292 270
33 3300005290 Ga0065712_10118156 Ga0065712_101181561 270
34 3300005334 Ga0068869_100298797 Ga0068869_1002987971 270
35 3300005343 Ga0070687_100059605 Ga0070687_1000596052 270
36 3300005347 Ga0070668_100076236 Ga0070668_1000762362 270
37 3300005353 Ga0070669_100234289 Ga0070669_1002342892 270
38 3300005354 Ga0070675_100034072 Ga0070675_1000340725 270
39 3300005365 Ga0070688_100012583 Ga0070688_1000125835 270
40 3300005367 Ga0070667_100225266 Ga0070667_1002252662 270
41 3300005438 Ga0070701_10028334 Ga0070701_100283342 270
42 3300005459 Ga0068867_100215609 Ga0068867_1002156092 270
43 3300005466 Ga0070685_10037144 Ga0070685_100371443 270
44 3300005466 Ga0070685_10148688 Ga0070685_101486882 270
45 3300005539 Ga0068853_100542738 Ga0068853_1005427381 270
46 3300005563 Ga0068855_100065679 Ga0068855_1000656792 270
47 3300005577 Ga0068857_100240883 Ga0068857_1002408832 270
48 3300005614 Ga0068856_100633107 Ga0068856_1006331072 270
49 3300005616 Ga0068852_100114841 Ga0068852_1001148413 270
50 3300005617 Ga0068859_100000646 Ga0068859_1000006466 270
51 3300005618 Ga0068864_100014569 Ga0068864_1000145693 270
52 3300005834 Ga0068851_10161580 Ga0068851_101615802 270
53 3300005841 Ga0068863_100011408 Ga0068863_1000114089 270
54 3300005841 Ga0068863_100325111 Ga0068863_1003251111 270
55 3300005842 Ga0068858_100390336 Ga0068858_1003903362 270
56 3300005843 Ga0068860_100008515 Ga0068860_1000085157 270
57 3300005937 Ga0081455_10108976 Ga0081455_101089763 270
58 3300006358 Ga0068871_100017691 Ga0068871_1000176912 270
59 3300006931 Ga0097620_100000646 Ga0097620_1000006466 270
60 3300009093 Ga0105240_10034239 Ga0105240_100342397 270
61 3300009093 Ga0105240_10075431 Ga0105240_100754312 270
62 3300009545 Ga0105237_10005717 Ga0105237_100057172 270
63 3300009545 Ga0105237_10034436 Ga0105237_100344362 270
64 3300009545 Ga0105237_10144295 Ga0105237_101442953 270
65 3300009553 Ga0105249_10163125 Ga0105249_101631252 270
66 3300009553 Ga0105249_10183155 Ga0105249_101831552 270
67 3300010375 Ga0105239_10002110 Ga0105239_1000211010 270
68 3300010375 Ga0105239_10003353 Ga0105239_100033537 270
69 3300013100 Ga0157373_10000074 Ga0157373_1000007465 270
70 3300013102 Ga0157371_10001093 Ga0157371_1000109314 270
71 3300013102 Ga0157371_10002143 Ga0157371_100021434 270
72 3300013104 Ga0157370_10004262 Ga0157370_100042626 270
73 3300013104 Ga0157370_10191497 Ga0157370_101914972 270
74 3300013297 Ga0157378_10294974 Ga0157378_102949742 270
75 3300013306 Ga0163162_10089517 Ga0163162_100895175 270
76 3300013307 Ga0157372_10331355 Ga0157372_103313552 270
77 3300014325 Ga0163163_10142855 Ga0163163_101428552 270
78 3300014326 Ga0157380_10374169 Ga0157380_103741691 270
79 3300015261 Ga0182006_1002231 Ga0182006_10022315 270
80 3300025321 Ga0207656_10049527 Ga0207656_100495272 270
81 3300025913 Ga0207695_10018473 Ga0207695_100184738 270
82 3300025913 Ga0207695_10093385 Ga0207695_100933851 270
83 3300025914 Ga0207671_10089064 Ga0207671_100890642 270
84 3300025918 Ga0207662_10029761 Ga0207662_100297614 270
85 3300025923 Ga0207681_10197280 Ga0207681_101972802 270
86 3300025934 Ga0207686_10000459 Ga0207686_1000045925 270
87 3300025936 Ga0207670_10007595 Ga0207670_100075952 270
88 3300025936 Ga0207670_10102481 Ga0207670_101024812 270
89 3300025936 Ga0207670_10395115 Ga0207670_103951151 270
90 3300025942 Ga0207689_10037648 Ga0207689_100376482 270
91 3300025949 Ga0207667_10087890 Ga0207667_100878902 270
92 3300025949 Ga0207667_10665838 Ga0207667_106658382 270
93 3300025960 Ga0207651_10038090 Ga0207651_100380903 270
94 3300025961 Ga0207712_10139902 Ga0207712_101399022 270
95 3300025961 Ga0207712_10580375 Ga0207712_105803752 270
96 3300025986 Ga0207658_10221005 Ga0207658_102210052 270
97 3300026041 Ga0207639_10541343 Ga0207639_105413431 270
98 3300026088 Ga0207641_10002576 Ga0207641_1000257618 270
99 3300026088 Ga0207641_10304005 Ga0207641_103040052 270
100 3300026095 Ga0207676_10082420 Ga0207676_100824204 270
101 3300026095 Ga0207676_10155046 Ga0207676_101550462 270
102 3300026118 Ga0207675_100208052 Ga0207675_1002080522 270
103 3300028380 Ga0268265_10054635 Ga0268265_100546354 270
104 3300028381 Ga0268264_10122380 Ga0268264_101223803 270
105 3300028381 Ga0268264_10184222 Ga0268264_101842222 270
106 3300031251 Ga0265327_10000164 Ga0265327_1000016426 270
107 3300031251 Ga0265327_10000415 Ga0265327_1000041526 270
108 3300031251 Ga0265327_10055185 Ga0265327_100551852 270
109 3300031911 Ga0307412_10000038 Ga0307412_1000003859 270
110 3300032004 Ga0307414_10016110 Ga0307414_100161103 270
111 3300046539 Ga0495621_0019217 Ga0495621_0019217_567_1391 270
112 3300049579 Ga0501043_0106510 Ga0501043_0106510_955_1779 270
113 3300049652 Ga0501202_005410 Ga0501202_005410_551_1375 270
114 3300049655 Ga0501208_019386 Ga0501208_019386_156_980 270
115 3300049661 Ga0501217_000029 Ga0501217_000029_398_1222 270
116 3300049662 Ga0501222_001152 Ga0501222_001152_2825_3649 270
117 3300049663 Ga0501223_007428 Ga0501223_007428_388_1212 270
118 3300049669 Ga0501235_000557 Ga0501235_000557_500_1324 270
119 3300049674 Ga0501242_000227 Ga0501242_000227_3028_3852 270
120 3300049675 Ga0501243_004917 Ga0501243_004917_969_1793 270
121 3300049675 Ga0501243_006975 Ga0501243_006975_421_1245 270
122 3300049678 Ga0501248_004081 Ga0501248_004081_242_1066 270
123 3300049688 Ga0501259_006328 Ga0501259_006328_56_880 270
124 3300049690 Ga0501261_003107 Ga0501261_003107_282_1106 270
125 3300049690 Ga0501261_004888 Ga0501261_004888_86_910 270
126 3300049705 Ga0501225_0002007 Ga0501225_0002007_1186_2010 270
127 3300049768 Ga0501271_001902 Ga0501271_001902_236_1060 270
128 3300049777 Ga0501281_03674 Ga0501281_03674_121_945 270
129 3300049779 Ga0501283_004598 Ga0501283_004598_932_1756 270
130 3300053093 Ga0500651_0000145 Ga0500651_0000145_38321_39145 270
131 iso_pu_bacteria 2738541284 2738761961 270
132 iso_pu_bacteria 2775506987 2776615395 270
133 iso_pu_bacteria 2911138879 2911142561 270
134 3300003316 rootH1_10025824 rootH1_100258241 271
135 3300003794 Ga0055531_10000263 Ga0055531_1000026321 271
136 3300005577 Ga0068857_100558218 Ga0068857_1005582182 271
137 3300009553 Ga0105249_10253742 Ga0105249_102537422 271
138 3300013307 Ga0157372_10004138 Ga0157372_100041388 271
139 3300025304 Ga0209257_1000025 Ga0209257_1000025278 271
140 3300026116 Ga0207674_10579561 Ga0207674_105795611 271
141 3300048929 Ga0496126_0006279 Ga0496126_0006279_1699_2532 271
142 3300049579 Ga0501043_0367881 Ga0501043_0367881_51_878 271
143 iso_pu_bacteria 2821136567 2821138917 271
144 iso_pu_bacteria 2904467357 2904472503 271
145 iso_pu_bacteria 2929239360 2929244719 271
146 3300003320 rootH2_10213590 rootH2_102135902 272
147 3300003322 rootL2_10312454 rootL2_103124542 272
148 3300030731 Ga0316177_1219627 Ga0316177_12196273 272
149 3300030732 Ga0316176_1020647 Ga0316176_102064719 272
150 iso_pu_bacteria 2842903701 2842904080 272
151 3300044673 Ga0453683_0000143 Ga0453683_0000143_89314_90147 273
152 3300044712 Ga0453684_0045816 Ga0453684_0045816_4479_5312 273
153 3300045051 Ga0451576_0054780 Ga0451576_0054780_441_1274 273
154 3300049570 Ga0501033_0082329 Ga0501033_0082329_400_1251 273
155 3300049574 Ga0501038_0038950 Ga0501038_0038950_2781_3632 273
156 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000272 274
157 3300013307 Ga0157372_10017898 Ga0157372_100178983 274
158 3300025938 Ga0207704_10109661 Ga0207704_101096612 274
159 3300030742 Ga0316183_1166136 Ga0316183_11661369 274
160 3300030744 Ga0316181_1042481 Ga0316181_104248111 274
161 3300035692 Ga0373935_0099956 Ga0373935_0099956_610_1464 274
162 3300044712 Ga0453684_0108012 Ga0453684_0108012_70_906 274
163 3300045051 Ga0451576_0324446 Ga0451576_0324446_176_1012 274
164 3300046459 Ga0495629_0034111 Ga0495629_0034111_306_1160 274
165 3300046477 Ga0495664_0106849 Ga0495664_0106849_502_1356 274
166 3300046663 Ga0495635_0317038 Ga0495635_0317038_135_989 274
167 3300046683 Ga0495658_0261981 Ga0495658_0261981_216_1070 274
168 3300049823 Ga0501044_0150120 Ga0501044_0150120_290_1126 274
169 3300050511 nmdc:mga08y16_30843_c1 nmdc:mga08y16_30843_c1_1148_1990 274
170 iso_pu_bacteria 2818991442 2819572764 274
171 iso_pu_bacteria 2910245624 2910246898 274
172 iso_pu_bacteria 2932082852 2932083577 274
173 3300015682 Ga0183373_1005 Ga0183373_100518 275
174 3300053136 Ga0500559_0013943 Ga0500559_0013943_1964_2803 275
175 iso_pu_bacteria 2849281842 2849285815 275
176 3300049569 Ga0501032_0054543 Ga0501032_0054543_1561_2421 276
177 3300049571 Ga0501034_0041203 Ga0501034_0041203_1116_1976 276
178 3300049581 Ga0501047_0131869 Ga0501047_0131869_754_1614 276
179 3300049822 Ga0501035_0076756 Ga0501035_0076756_730_1590 276
180 2162886007 SwRhRL2b_contig_2468263 SwRhRL2b_0103.00000460 278
181 3300005289 Ga0065704_10073630 Ga0065704_100736305 278
182 3300009174 Ga0105241_10049347 Ga0105241_100493473 278
183 3300009545 Ga0105237_10030153 Ga0105237_100301532 278
184 3300025949 Ga0207667_10073720 Ga0207667_100737202 278
185 3300026078 Ga0207702_10059616 Ga0207702_100596162 278
186 3300050507 nmdc:mga05p37_4327_c1 nmdc:mga05p37_4327_c1_6162_7025 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

56

292

0.85

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

55

297

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q7q-assembly2.cif.gz_B the crystal structure of a possible lipase from chitinophaga pinensis dsm 2588 0.9901 21 277
4q7q-assembly2.cif.gz_B the crystal structure of a possible lipase from chitinophaga pinensis dsm 2588 0.9863 21 277
3dc7-assembly1.cif.gz_C crystal structure of the protein q88sr8 from lactobacillus plantarum. northeast structural genomics consortium target lpr109. 0.8307 20 273
3dc7-assembly1.cif.gz_C crystal structure of the protein q88sr8 from lactobacillus plantarum. northeast structural genomics consortium target lpr109. 0.8084 20 273
7bxd-assembly1.cif.gz_A crystal structure of ca_00815 0.7867 20 278
ID Description Score Start End Superfamily
4q7qB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9889 21 277 3.40.50.1110
4q7qB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9851 21 277 3.40.50.1110
3dc7C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8322 20 273 3.40.50.1110
3dc7C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8093 20 273 3.40.50.1110
af_Q2FX67_418_632_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7636 22 274 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A258MXY7-F1-model_v4 GDSL family lipase 0.994 23 273 GO:0004622
AF-A0A4Q3CWG9-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9921 17 278 GO:0016787
AF-A0A4Q3T0R0-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9895 48 271 GO:0016787
AF-A0A4Q3CBN6-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9881 95 275 GO:0016788
AF-F4L658-F1-model_v4 Lipolytic protein G-D-S-L family 0.9823 3 271 GO:0004622
GO:0016020

Feature Viewer

pLDDT pTM Quality
92.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map