F285881

General Info

Members Datasets Scaffolds Average Seq Length
186 109 182 318

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10129778|Ga0105240_101297782
Length 364
Sequence MDTTKVFGRHVGTRQLLFAVAVLVCLTPWVTPPVALVLGLVVALFIGHPFLHLNHKATHILLQVSVVGLGFGMNASSAAKAGREGFLFTVVSILGTLAVGLLMGRFFRIDRKTSLLISGGTAICXXXXIAALSPVIRAEERQVSVALGVVFILNSVALFLFPVVGHFLGLSQTQFGLWSAIAIHDTSSVVGAAGRYGPEALQIATTVKLARALWIIPVSVAAALAFGGRGGSAPAHGKPGGKVKVPWFIGLFVVAILVNTWMPVPVVSHAIVGAAHSGLTLTLFLIGSGLSGQVLKIPERSEGNGRGSRGIEGNDREEARDEASTKVSRDDAPTKSWVKPLMQGVLLWVMISGVALCAVVSLVK

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
100 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
108 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0
Rhizoplane 0
Rhizosphere 84.41
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1008205 3300002739 Bacteria 1456
2 rootH2_10002195 3300003320 Bacteria 18788
3 rootH2_10024022 3300003320 Bacteria 28042
4 rootH2_10029719 3300003320 Bacteria 12881
5 rootH2_10140591 3300003320 Bacteria 3276
6 rootL2_10019924 3300003322 Bacteria 1304
7 rootH1_10063750 3300003323 Bacteria 6782
8 Ga0055536_1000009 3300003781 Bacteria 311572
9 Ga0055531_10000036 3300003794 Bacteria 147042
10 Ga0065714_10067102 3300005288 Bacteria 5883
11 Ga0065714_10074825 3300005288 Bacteria 2986
12 Ga0070658_10098814 3300005327 Bacteria 2411
13 Ga0070658_10187903 3300005327 Bacteria 1741
14 Ga0070680_100049950 3300005336 Bacteria 3411
15 Ga0070660_100003504 3300005339 Bacteria 10812
16 Ga0070660_100034030 3300005339 Bacteria 3847
17 Ga0070659_100014925 3300005366 Bacteria 5810
18 Ga0070663_100012028 3300005455 Bacteria 5460
19 Ga0070663_100037698 3300005455 Bacteria 3367
20 Ga0070681_10017653 3300005458 Bacteria 7131
21 Ga0070681_10073631 3300005458 Bacteria 3378
22 Ga0070681_10359044 3300005458 Unclassified 1367
23 Ga0070679_100064487 3300005530 Bacteria 3651
24 Ga0070679_100186723 3300005530 Unclassified 2043
25 Ga0068853_100002356 3300005539 Bacteria 14137
26 Ga0068853_100036348 3300005539 Bacteria 4187
27 Ga0068855_100010029 3300005563 Bacteria 11417
28 Ga0068855_100016036 3300005563 Bacteria 9014
29 Ga0068855_100024467 3300005563 Bacteria 7224
30 Ga0068855_100534944 3300005563 Bacteria 1270
31 Ga0068857_100024390 3300005577 Bacteria 5324
32 Ga0068854_100081056 3300005578 Bacteria 2396
33 Ga0068856_100052003 3300005614 Bacteria 4039
34 Ga0068852_100001291 3300005616 Bacteria 16734
35 Ga0068852_100019254 3300005616 Bacteria 5397
36 Ga0105240_10000986 3300009093 Bacteria 50790
37 Ga0105240_10001726 3300009093 Bacteria 36894
38 Ga0105240_10007430 3300009093 Bacteria 15917
39 Ga0105240_10018227 3300009093 Bacteria 9436
40 Ga0105240_10075317 3300009093 Bacteria 4163
41 Ga0105240_10129778 3300009093 Bacteria 3025
42 Ga0105240_10201122 3300009093 Bacteria 2334
43 Ga0105241_10007405 3300009174 Bacteria 8076
44 Ga0105237_10000331 3300009545 Bacteria 66733
45 Ga0105237_10000588 3300009545 Bacteria 50672
46 Ga0105237_10005937 3300009545 Bacteria 13692
47 Ga0105237_10125341 3300009545 Unclassified 2563
48 Ga0105237_10408131 3300009545 Bacteria 1363
49 Ga0105239_10000083 3300010375 Bacteria 132046
50 Ga0105239_10000884 3300010375 Bacteria 42500
51 Ga0105239_10019747 3300010375 Bacteria 7437
52 Ga0105239_10026965 3300010375 Bacteria 6324
53 Ga0105239_10150022 3300010375 Unclassified 2602
54 Ga0157373_10098327 3300013100 Bacteria 2059
55 Ga0157371_10000596 3300013102 Bacteria 43030
56 Ga0157371_10000752 3300013102 Bacteria 37521
57 Ga0157371_10008292 3300013102 Bacteria 8298
58 Ga0157371_10030257 3300013102 Unclassified 3906
59 Ga0157370_10000132 3300013104 Bacteria 89678
60 Ga0157370_10000238 3300013104 Bacteria 70036
61 Ga0157370_10001205 3300013104 Bacteria 32309
62 Ga0157370_10002675 3300013104 Bacteria 21354
63 Ga0157370_10103917 3300013104 Bacteria 2659
64 Ga0157370_10376879 3300013104 Bacteria 1307
65 Ga0157369_10011026 3300013105 Bacteria 10285
66 Ga0157369_10031277 3300013105 Bacteria 5862
67 Ga0157369_10085191 3300013105 Bacteria 3377
68 Ga0157374_10000003 3300013296 Bacteria 854471
69 Ga0157372_10005181 3300013307 Bacteria 13866
70 Ga0157372_10011562 3300013307 Bacteria 9391
71 Ga0157372_10013390 3300013307 Bacteria 8757
72 Ga0157372_10034246 3300013307 Bacteria 5583
73 Ga0157372_10065424 3300013307 Bacteria 4082
74 Ga0157372_10074956 3300013307 Bacteria 3817
75 Ga0157372_10124342 3300013307 Bacteria 2965
76 Ga0157372_10460166 3300013307 Bacteria 1483
77 Ga0157375_10036774 3300013308 Bacteria 4687
78 Ga0182008_10000614 3300014497 Bacteria 26183
79 Ga0157376_10004314 3300014969 Bacteria 9879
80 Ga0182006_1000521 3300015261 Bacteria 29292
81 Ga0182005_1000876 3300015265 Bacteria 13338
82 Ga0163161_10000705 3300017792 Bacteria 26566
83 Ga0209436_101312 3300025208 Bacteria 8843
84 Ga0209455_1002119 3300025272 Bacteria 7876
85 Ga0207426_1002492 3300025302 Bacteria 11668
86 Ga0209257_1000008 3300025304 Bacteria 1294570
87 Ga0207647_10004200 3300025904 Bacteria 10682
88 Ga0207647_10128046 3300025904 Bacteria 1493
89 Ga0207705_10072982 3300025909 Bacteria 2489
90 Ga0207654_10055825 3300025911 Bacteria 2288
91 Ga0207707_10020911 3300025912 Bacteria 5716
92 Ga0207695_10000447 3300025913 Bacteria 90113
93 Ga0207695_10000981 3300025913 Bacteria 50713
94 Ga0207695_10013369 3300025913 Bacteria 9795
95 Ga0207695_10071363 3300025913 Bacteria 3547
96 Ga0207695_10338905 3300025913 Bacteria 1391
97 Ga0207695_10504346 3300025913 Bacteria 1092
98 Ga0207671_10000709 3300025914 Bacteria 42749
99 Ga0207671_10014946 3300025914 Bacteria 6102
100 Ga0207671_10056488 3300025914 Bacteria 2909
101 Ga0207671_10296076 3300025914 Bacteria 1278
102 Ga0207660_10007152 3300025917 Bacteria 7228
103 Ga0207652_10000383 3300025921 Bacteria 46096
104 Ga0207652_10377560 3300025921 Bacteria 1279
105 Ga0207694_10044398 3300025924 Unclassified 3432
106 Ga0207667_10008503 3300025949 Bacteria 12187
107 Ga0207667_10053271 3300025949 Bacteria 4258
108 Ga0207667_10431211 3300025949 Bacteria 1341
109 Ga0207640_10070769 3300025981 Bacteria 2347
110 Ga0207639_10000006 3300026041 Bacteria 544415
111 Ga0207639_10065610 3300026041 Bacteria 2819
112 Ga0207678_10021157 3300026067 Bacteria 5701
113 Ga0207678_10062958 3300026067 Bacteria 3188
114 Ga0207702_10087663 3300026078 Bacteria 2718
115 Ga0207674_10017354 3300026116 Bacteria 7854
116 Ga0307517_10141615 3300028786 Bacteria 1686
117 Ga0265338_10003068 3300028800 Bacteria 23988
118 Ga0265327_10000234 3300031251 Bacteria 112034
119 Ga0307510_10000079 3300033180 Bacteria 73286
120 Ga0395899_0000050 3300037312 Bacteria 224591
121 Ga0395899_0007724 3300037312 Bacteria 8293
122 Ga0395900_0067052 3300037418 Unclassified 3687
123 Ga0395900_0085773 3300037418 Unclassified 3236
124 Ga0395898_0027852 3300037466 Bacteria 5667
125 Ga0395898_0032595 3300037466 Bacteria 5201
126 Ga0395898_0124463 3300037466 Bacteria 2470
127 Ga0395905_0007136 3300037471 Bacteria 11170
128 Ga0395905_0122724 3300037471 Bacteria 2442
129 Ga0395901_0006842 3300038443 Bacteria 11516
130 Ga0395901_0119245 3300038443 Bacteria 2772
131 Ga0395901_0181550 3300038443 Bacteria 2207
132 Ga0395901_0357888 3300038443 Unclassified 1505
133 Ga0453683_0053524 3300044673 Bacteria 2526
134 Ga0453683_0277585 3300044673 Unclassified 1070
135 Ga0453684_0001426 3300044712 Bacteria 68576
136 Ga0466970_0065745 3300044765 Bacteria 1946
137 Ga0466960_0018046 3300044901 Bacteria 3087
138 Ga0466959_0006216 3300045049 Bacteria 8256
139 Ga0495606_0004013 3300046507 Bacteria 15016
140 Ga0495606_0014297 3300046507 Bacteria 6207
141 Ga0495648_0003202 3300046524 Bacteria 14529
142 Ga0495652_0125969 3300046529 Bacteria 2035
143 Ga0495634_0155538 3300046642 Bacteria 1443
144 Ga0495611_0000727 3300046648 Bacteria 18510
145 Ga0495611_0014688 3300046648 Bacteria 3348
146 Ga0495625_0118167 3300046660 Bacteria 1807
147 Ga0495649_0099527 3300046694 Unclassified 1546
148 Ga0495686_0000039 3300047472 Bacteria 304821
149 Ga0496116_0012235 3300048919 Bacteria 7018
150 Ga0496117_0001275 3300048920 Bacteria 37368
151 Ga0496122_0007946 3300048925 Bacteria 11605
152 Ga0496123_0003263 3300048926 Bacteria 18398
153 Ga0496123_0021055 3300048926 Bacteria 5081
154 Ga0496125_0230084 3300048928 Bacteria 1186
155 Ga0496126_0022098 3300048929 Bacteria 6196
156 Ga0501031_0000757 3300049568 Bacteria 19442
157 Ga0501032_0007292 3300049569 Bacteria 8093
158 Ga0501033_0000028 3300049570 Bacteria 161436
159 Ga0501033_0214012 3300049570 Bacteria 1374
160 Ga0501034_0000074 3300049571 Bacteria 175369
161 Ga0501034_0261342 3300049571 Bacteria 1674
162 Ga0501036_0061774 3300049572 Bacteria 3173
163 Ga0501037_0137802 3300049573 Bacteria 1747
164 Ga0501038_0038088 3300049574 Bacteria 4212
165 Ga0501038_0252785 3300049574 Bacteria 1395
166 Ga0501039_0003283 3300049575 Bacteria 12098
167 Ga0501043_0002401 3300049579 Bacteria 15856
168 Ga0501043_0036238 3300049579 Bacteria 3880
169 Ga0501048_0035049 3300049582 Bacteria 3615
170 Ga0501070_0091335 3300049586 Bacteria 2520
171 Ga0501219_000251 3300049703 Bacteria 9840
172 Ga0501241_004238 3300049758 Bacteria 2694
173 Ga0501035_0005702 3300049822 Bacteria 11748
174 Ga0501044_0001410 3300049823 Bacteria 28196
175 Ga0501045_0000380 3300049824 Bacteria 26716
176 Ga0501284_00025 3300050005 Bacteria 76385
177 Ga0500583_0009890 3300053092 Bacteria 3510
178 Ga0500642_0036706 3300053130 Bacteria 2090
179 Ga0500577_0000987 3300053142 Bacteria 7341
180 Ga0500622_0000305 3300053156 Bacteria 50294
181 Ga0500622_0003012 3300053156 Bacteria 11644
182 Ga0466962_0040043 3300061719 Bacteria 2244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0125969 Ga0495652_0125969_583_1524 259
2 3300046642 Ga0495634_0155538 Ga0495634_0155538_69_1010 259
3 3300044673 Ga0453683_0277585 Ga0453683_0277585_251_1051 262
4 3300025914 Ga0207671_10014946 Ga0207671_100149465 268
5 3300003322 rootL2_10019924 rootL2_100199241 272
6 3300049570 Ga0501033_0214012 Ga0501033_0214012_141_1094 272
7 3300049574 Ga0501038_0038088 Ga0501038_0038088_579_1532 272
8 3300009093 Ga0105240_10201122 Ga0105240_102011222 275
9 3300005539 Ga0068853_100036348 Ga0068853_1000363483 287
10 3300009093 Ga0105240_10018227 Ga0105240_100182271 287
11 3300025913 Ga0207695_10504346 Ga0207695_105043461 287
12 3300026041 Ga0207639_10000006 Ga0207639_10000006442 287
13 3300046524 Ga0495648_0003202 Ga0495648_0003202_8116_9093 287
14 3300046648 Ga0495611_0014688 Ga0495611_0014688_1150_2127 287
15 3300053092 Ga0500583_0009890 Ga0500583_0009890_1285_2262 287
16 3300053156 Ga0500622_0003012 Ga0500622_0003012_4565_5542 287
17 3300003794 Ga0055531_10000036 Ga0055531_1000003683 288
18 3300025304 Ga0209257_1000008 Ga0209257_100000850 288
19 3300048929 Ga0496126_0022098 Ga0496126_0022098_4802_5803 288
20 3300003323 rootH1_10063750 rootH1_100637507 290
21 3300009545 Ga0105237_10125341 Ga0105237_101253412 291
22 3300010375 Ga0105239_10150022 Ga0105239_101500222 291
23 3300025914 Ga0207671_10056488 Ga0207671_100564883 291
24 3300003320 rootH2_10140591 rootH2_101405914 292
25 3300028786 Ga0307517_10141615 Ga0307517_101416152 292
26 3300025913 Ga0207695_10338905 Ga0207695_103389051 293
27 3300033180 Ga0307510_10000079 Ga0307510_1000007926 293
28 3300046507 Ga0495606_0004013 Ga0495606_0004013_13794_14777 293
29 3300053156 Ga0500622_0000305 Ga0500622_0000305_1365_2366 294
30 3300003320 rootH2_10024022 rootH2_100240223 295
31 3300010375 Ga0105239_10000884 Ga0105239_100008842 295
32 3300005539 Ga0068853_100002356 Ga0068853_10000235613 297
33 3300005616 Ga0068852_100019254 Ga0068852_1000192542 297
34 3300010375 Ga0105239_10019747 Ga0105239_100197472 297
35 3300044712 Ga0453684_0001426 Ga0453684_0001426_61389_62333 297
36 3300046648 Ga0495611_0000727 Ga0495611_0000727_14613_15620 297
37 3300009093 Ga0105240_10000986 Ga0105240_1000098621 298
38 3300010375 Ga0105239_10026965 Ga0105239_100269652 298
39 3300013307 Ga0157372_10005181 Ga0157372_100051813 298
40 3300025913 Ga0207695_10013369 Ga0207695_100133696 298
41 3300026041 Ga0207639_10065610 Ga0207639_100656102 298
42 3300046694 Ga0495649_0099527 Ga0495649_0099527_106_1137 298
43 3300049568 Ga0501031_0000757 Ga0501031_0000757_13243_14220 298
44 3300049569 Ga0501032_0007292 Ga0501032_0007292_4171_5148 298
45 3300049570 Ga0501033_0000028 Ga0501033_0000028_69356_70333 298
46 3300049571 Ga0501034_0000074 Ga0501034_0000074_76232_77209 298
47 3300049572 Ga0501036_0061774 Ga0501036_0061774_2006_2983 298
48 3300049573 Ga0501037_0137802 Ga0501037_0137802_298_1275 298
49 3300049574 Ga0501038_0252785 Ga0501038_0252785_165_1142 298
50 3300049575 Ga0501039_0003283 Ga0501039_0003283_2968_3945 298
51 3300049579 Ga0501043_0002401 Ga0501043_0002401_10709_11686 298
52 3300049582 Ga0501048_0035049 Ga0501048_0035049_2611_3588 298
53 3300049586 Ga0501070_0091335 Ga0501070_0091335_477_1454 298
54 3300049822 Ga0501035_0005702 Ga0501035_0005702_4256_5233 298
55 3300049823 Ga0501044_0001410 Ga0501044_0001410_10830_11807 298
56 3300049824 Ga0501045_0000380 Ga0501045_0000380_14331_15308 298
57 3300009093 Ga0105240_10007430 Ga0105240_1000743016 299
58 3300009545 Ga0105237_10408131 Ga0105237_104081311 299
59 3300025913 Ga0207695_10000447 Ga0207695_1000044779 299
60 3300025913 Ga0207695_10000981 Ga0207695_1000098136 299
61 3300013307 Ga0157372_10074956 Ga0157372_100749562 300
62 3300005458 Ga0070681_10073631 Ga0070681_100736312 302
63 3300028800 Ga0265338_10003068 Ga0265338_100030686 302
64 3300044673 Ga0453683_0053524 Ga0453683_0053524_1081_2004 302
65 3300003320 rootH2_10002195 rootH2_1000219518 304
66 3300005339 Ga0070660_100003504 Ga0070660_10000350412 304
67 3300003320 rootH2_10029719 rootH2_1002971910 305
68 3300005339 Ga0070660_100034030 Ga0070660_1000340302 305
69 3300005366 Ga0070659_100014925 Ga0070659_1000149251 305
70 3300005530 Ga0070679_100064487 Ga0070679_1000644872 305
71 3300005563 Ga0068855_100010029 Ga0068855_10001002911 305
72 3300013102 Ga0157371_10000596 Ga0157371_1000059616 305
73 3300013104 Ga0157370_10000238 Ga0157370_1000023852 305
74 3300044765 Ga0466970_0065745 Ga0466970_0065745_269_1240 305
75 3300045049 Ga0466959_0006216 Ga0466959_0006216_4622_5593 305
76 3300046660 Ga0495625_0118167 Ga0495625_0118167_225_1172 305
77 3300061719 Ga0466962_0040043 Ga0466962_0040043_174_1145 305
78 3300005288 Ga0065714_10067102 Ga0065714_100671024 306
79 3300005288 Ga0065714_10074825 Ga0065714_100748252 306
80 3300025921 Ga0207652_10377560 Ga0207652_103775602 306
81 3300038443 Ga0395901_0119245 Ga0395901_0119245_419_1396 306
82 3300009545 Ga0105237_10005937 Ga0105237_1000593711 307
83 3300013104 Ga0157370_10000132 Ga0157370_1000013225 307
84 3300014497 Ga0182008_10000614 Ga0182008_100006148 307
85 3300015261 Ga0182006_1000521 Ga0182006_100052116 307
86 3300017792 Ga0163161_10000705 Ga0163161_1000070512 307
87 3300025914 Ga0207671_10296076 Ga0207671_102960762 307
88 3300048925 Ga0496122_0007946 Ga0496122_0007946_7673_8608 307
89 3300048926 Ga0496123_0003263 Ga0496123_0003263_11511_12446 307
90 3300048928 Ga0496125_0230084 Ga0496125_0230084_67_1002 307
91 3300013104 Ga0157370_10376879 Ga0157370_103768791 309
92 iso_pu_bacteria 2721755487 2722726682 309
93 3300005563 Ga0068855_100024467 Ga0068855_1000244673 310
94 3300009093 Ga0105240_10129778 Ga0105240_101297782 310
95 3300009545 Ga0105237_10000588 Ga0105237_1000058841 310
96 3300010375 Ga0105239_10000083 Ga0105239_10000083113 310
97 3300013296 Ga0157374_10000003 Ga0157374_10000003399 310
98 3300013307 Ga0157372_10034246 Ga0157372_100342466 310
99 3300013308 Ga0157375_10036774 Ga0157375_100367742 310
100 3300014969 Ga0157376_10004314 Ga0157376_100043148 310
101 3300031251 Ga0265327_10000234 Ga0265327_10000234103 310
102 3300047472 Ga0495686_0000039 Ga0495686_0000039_223914_224897 310
103 3300003781 Ga0055536_1000009 Ga0055536_1000009177 311
104 3300005327 Ga0070658_10098814 Ga0070658_100988142 311
105 3300005327 Ga0070658_10187903 Ga0070658_101879031 311
106 3300005336 Ga0070680_100049950 Ga0070680_1000499502 311
107 3300005455 Ga0070663_100012028 Ga0070663_1000120286 311
108 3300005455 Ga0070663_100037698 Ga0070663_1000376982 311
109 3300005458 Ga0070681_10017653 Ga0070681_100176535 311
110 3300005458 Ga0070681_10359044 Ga0070681_103590442 311
111 3300005530 Ga0070679_100186723 Ga0070679_1001867232 311
112 3300005563 Ga0068855_100016036 Ga0068855_1000160363 311
113 3300005563 Ga0068855_100534944 Ga0068855_1005349442 311
114 3300005577 Ga0068857_100024390 Ga0068857_1000243905 311
115 3300005578 Ga0068854_100081056 Ga0068854_1000810561 311
116 3300005614 Ga0068856_100052003 Ga0068856_1000520033 311
117 3300005616 Ga0068852_100001291 Ga0068852_1000012913 311
118 3300009093 Ga0105240_10001726 Ga0105240_1000172621 311
119 3300009093 Ga0105240_10075317 Ga0105240_100753174 311
120 3300009174 Ga0105241_10007405 Ga0105241_100074057 311
121 3300009545 Ga0105237_10000331 Ga0105237_1000033117 311
122 3300013100 Ga0157373_10098327 Ga0157373_100983272 311
123 3300013102 Ga0157371_10000752 Ga0157371_1000075222 311
124 3300013102 Ga0157371_10008292 Ga0157371_100082924 311
125 3300013102 Ga0157371_10030257 Ga0157371_100302574 311
126 3300013104 Ga0157370_10001205 Ga0157370_1000120522 311
127 3300013104 Ga0157370_10002675 Ga0157370_100026758 311
128 3300013104 Ga0157370_10103917 Ga0157370_101039172 311
129 3300013105 Ga0157369_10011026 Ga0157369_100110264 311
130 3300013105 Ga0157369_10031277 Ga0157369_100312774 311
131 3300013105 Ga0157369_10085191 Ga0157369_100851912 311
132 3300013307 Ga0157372_10011562 Ga0157372_100115625 311
133 3300013307 Ga0157372_10013390 Ga0157372_100133904 311
134 3300013307 Ga0157372_10065424 Ga0157372_100654243 311
135 3300013307 Ga0157372_10124342 Ga0157372_101243424 311
136 3300013307 Ga0157372_10460166 Ga0157372_104601661 311
137 3300025272 Ga0209455_1002119 Ga0209455_10021199 311
138 3300025904 Ga0207647_10004200 Ga0207647_100042006 311
139 3300025904 Ga0207647_10128046 Ga0207647_101280461 311
140 3300025909 Ga0207705_10072982 Ga0207705_100729822 311
141 3300025911 Ga0207654_10055825 Ga0207654_100558252 311
142 3300025912 Ga0207707_10020911 Ga0207707_100209113 311
143 3300025913 Ga0207695_10071363 Ga0207695_100713632 311
144 3300025914 Ga0207671_10000709 Ga0207671_1000070927 311
145 3300025917 Ga0207660_10007152 Ga0207660_100071524 311
146 3300025921 Ga0207652_10000383 Ga0207652_1000038332 311
147 3300025924 Ga0207694_10044398 Ga0207694_100443982 311
148 3300025949 Ga0207667_10008503 Ga0207667_100085039 311
149 3300025949 Ga0207667_10053271 Ga0207667_100532712 311
150 3300025949 Ga0207667_10431211 Ga0207667_104312111 311
151 3300025981 Ga0207640_10070769 Ga0207640_100707692 311
152 3300026067 Ga0207678_10021157 Ga0207678_100211573 311
153 3300026067 Ga0207678_10062958 Ga0207678_100629583 311
154 3300026078 Ga0207702_10087663 Ga0207702_100876632 311
155 3300026116 Ga0207674_10017354 Ga0207674_100173547 311
156 3300037312 Ga0395899_0000050 Ga0395899_0000050_81034_81996 311
157 3300037312 Ga0395899_0007724 Ga0395899_0007724_3574_4599 311
158 3300037418 Ga0395900_0067052 Ga0395900_0067052_595_1620 311
159 3300037418 Ga0395900_0085773 Ga0395900_0085773_327_1322 311
160 3300037466 Ga0395898_0027852 Ga0395898_0027852_3728_4753 311
161 3300037466 Ga0395898_0032595 Ga0395898_0032595_1162_2142 311
162 3300037466 Ga0395898_0124463 Ga0395898_0124463_205_1200 311
163 3300037471 Ga0395905_0007136 Ga0395905_0007136_2898_3878 311
164 3300037471 Ga0395905_0122724 Ga0395905_0122724_752_1732 311
165 3300038443 Ga0395901_0006842 Ga0395901_0006842_5851_6831 311
166 3300038443 Ga0395901_0181550 Ga0395901_0181550_978_2003 311
167 3300038443 Ga0395901_0357888 Ga0395901_0357888_227_1207 311
168 3300044901 Ga0466960_0018046 Ga0466960_0018046_2071_3039 311
169 3300046507 Ga0495606_0014297 Ga0495606_0014297_662_1672 311
170 3300048919 Ga0496116_0012235 Ga0496116_0012235_72_1046 311
171 3300048920 Ga0496117_0001275 Ga0496117_0001275_26093_27067 311
172 3300048926 Ga0496123_0021055 Ga0496123_0021055_241_1215 311
173 3300049571 Ga0501034_0261342 Ga0501034_0261342_645_1619 311
174 3300049579 Ga0501043_0036238 Ga0501043_0036238_1936_2910 311
175 3300049703 Ga0501219_000251 Ga0501219_000251_503_1471 311
176 3300049758 Ga0501241_004238 Ga0501241_004238_178_1146 311
177 3300050005 Ga0501284_00025 Ga0501284_00025_45655_46623 311
178 3300053130 Ga0500642_0036706 Ga0500642_0036706_1086_2069 311
179 3300053142 Ga0500577_0000987 Ga0500577_0000987_3215_4165 311
180 iso_pu_bacteria 2914759650 2914759991 311
181 iso_pu_bacteria 2818991442 2819575436 312
182 iso_pu_bacteria 2821136567 2821137980 312
183 3300002739 JGI25158J39367_1008205 JGI25158J39367_10082052 316
184 3300015265 Ga0182005_1000876 Ga0182005_10008769 316
185 3300025208 Ga0209436_101312 Ga0209436_1013122 316
186 3300025302 Ga0207426_1002492 Ga0207426_10024922 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03601

Cons_hypoth698

Conserved hypothetical protein 698

15

300

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b4m-assembly1.cif.gz_A cryoem structure of the human sodium proton exchanger nha2 in nanodisc 0.4551 16 316
7p1i-assembly1.cif.gz_B cryo em structure of bison nha2 in detergent and n-terminal extension helix 0.4486 36 316
7b4m-assembly1.cif.gz_A cryoem structure of the human sodium proton exchanger nha2 in nanodisc 0.4358 16 316
8bxg-assembly1.cif.gz_A structure of the k/h exchanger kefc. 0.4261 17 314
8otw-assembly1.cif.gz_B cryo-em structure of strongylocentrotus purpuratus slc9c1 in presence of camp 0.4227 1 310
ID Description Score Start End Superfamily
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9211 38 296 1.20.1530.20
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7749 38 296 1.20.1530.20
af_Q2G134_11_311_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6747 13 296 1.20.1530.20
af_Q2G134_11_311_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6428 13 296 1.20.1530.20
af_P39830_6_397_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.4741 15 314 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A3D9G1S9-F1-model_v4 Putative integral membrane protein (TIGR00698 family) 0.9923 12 313 GO:0005886
AF-A0A4Q0T555-F1-model_v4 Putative membrane protein YeiH 0.9841 15 314 GO:0005886
AF-A0A1T5HGW1-F1-model_v4 Conserved hypothetical integral membrane protein 0.9819 4 316 GO:0005886
AF-A0A4R6UXD6-F1-model_v4 Putative integral membrane protein (TIGR00698 family) 0.9818 15 315 GO:0005886
AF-A0A2E2WI35-F1-model_v4 Putative sulfate exporter family transporter 0.981 17 316 GO:0005886

Feature Viewer

pLDDT pTM Quality
87.16 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map