F285747

General Info

Members Datasets Scaffolds Average Seq Length
186 122 181 107

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10015393|Ga0081538_100153936
Length 123
Sequence MRARASAGRSRNSEAGMTTFDKREEGFEKQFAVDQELKFKATARRNKLLGLWAAGKLGLAGDEAETYAKAVVAADFEEAGDHDVFRKIRRDFDAKGVGESDHQIRRTMDELMAKAVEAIKAGK

Samples

Sample ID Description Type Environment
1 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
2 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
3 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
4 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
5 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
51 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
52 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 1.61
Rhizoplane 5.38
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000846 3300003320 Bacteria 5504
2 Ga0065707_11139099 3300005295 Bacteria 507
3 Ga0070709_10310874 3300005434 Bacteria 1153
4 Ga0070709_10482503 3300005434 Bacteria 939
5 Ga0070709_10793559 3300005434 Bacteria 743
6 Ga0070714_100443278 3300005435 Bacteria 1232
7 Ga0070714_101099993 3300005435 Bacteria 774
8 Ga0070714_102226494 3300005435 Bacteria 533
9 Ga0070713_100079111 3300005436 Bacteria 2800
10 Ga0070713_100227417 3300005436 Bacteria 1695
11 Ga0070713_100367625 3300005436 Bacteria 1337
12 Ga0070713_100381349 3300005436 Bacteria 1313
13 Ga0070713_100408377 3300005436 Bacteria 1269
14 Ga0070710_10105896 3300005437 Bacteria 1682
15 Ga0070711_101517548 3300005439 Bacteria 585
16 Ga0070706_100464437 3300005467 Bacteria 1178
17 Ga0070699_100023172 3300005518 Bacteria 5349
18 Ga0070696_100030227 3300005546 Bacteria 3708
19 Ga0068856_100399922 3300005614 Bacteria 1393
20 Ga0068856_100690046 3300005614 Bacteria 1041
21 Ga0068861_102206722 3300005719 Bacteria 552
22 Ga0081455_10154662 3300005937 Bacteria 1765
23 Ga0081455_10442170 3300005937 Bacteria 891
24 Ga0081538_10015393 3300005981 Bacteria 5922
25 Ga0081540_1017584 3300005983 Bacteria 4420
26 Ga0081540_1080404 3300005983 Bacteria 1469
27 Ga0070717_10427966 3300006028 Bacteria 1191
28 Ga0070717_10467422 3300006028 Bacteria 1138
29 Ga0070717_10734397 3300006028 Bacteria 897
30 Ga0075363_100557431 3300006048 Bacteria 684
31 Ga0075364_10612266 3300006051 Bacteria 744
32 Ga0070716_100771646 3300006173 Bacteria 742
33 Ga0070716_101643078 3300006173 Bacteria 529
34 Ga0070712_100013128 3300006175 Bacteria 5284
35 Ga0070712_100025647 3300006175 Bacteria 3921
36 Ga0070712_100523161 3300006175 Bacteria 996
37 Ga0070712_100575064 3300006175 Bacteria 951
38 Ga0070712_101564688 3300006175 Bacteria 576
39 Ga0075362_10574680 3300006177 Bacteria 581
40 Ga0075428_100151357 3300006844 Bacteria 2521
41 Ga0075428_102435426 3300006844 Bacteria 537
42 Ga0075431_100736233 3300006847 Bacteria 962
43 Ga0075433_10779687 3300006852 Bacteria 836
44 Ga0075436_100050491 3300006914 Bacteria 2870
45 Ga0075436_100484831 3300006914 Bacteria 903
46 Ga0075435_100049683 3300007076 Bacteria 3374
47 Ga0075435_101201199 3300007076 Bacteria 663
48 Ga0099795_10009005 3300007788 Bacteria 2878
49 Ga0114129_10114486 3300009147 Bacteria 3718
50 Ga0114129_10399460 3300009147 Bacteria 1811
51 Ga0099796_10000638 3300010159 Bacteria 6096
52 Ga0182008_10031326 3300014497 Bacteria 2678
53 Ga0213873_10033027 3300021358 Bacteria 1296
54 Ga0213876_10029875 3300021384 Bacteria 2873
55 Ga0213876_10429831 3300021384 Bacteria 702
56 Ga0207692_10099456 3300025898 Bacteria 1593
57 Ga0207692_10149089 3300025898 Bacteria 1338
58 Ga0207693_10013560 3300025915 Bacteria 6569
59 Ga0207693_10046710 3300025915 Bacteria 3402
60 Ga0207693_10297691 3300025915 Bacteria 1264
61 Ga0207693_10496080 3300025915 Bacteria 953
62 Ga0207693_10570716 3300025915 Bacteria 882
63 Ga0207693_10644095 3300025915 Bacteria 823
64 Ga0207663_10404581 3300025916 Unclassified 1045
65 Ga0207663_10532707 3300025916 Bacteria 916
66 Ga0207700_10034926 3300025928 Bacteria 3615
67 Ga0207700_10229898 3300025928 Bacteria 1576
68 Ga0207700_10242349 3300025928 Bacteria 1537
69 Ga0207700_11496172 3300025928 Bacteria 599
70 Ga0207700_11597266 3300025928 Bacteria 577
71 Ga0207664_10399387 3300025929 Bacteria 1222
72 Ga0207664_11246807 3300025929 Bacteria 662
73 Ga0207644_10465600 3300025931 Bacteria 1040
74 Ga0207665_10327378 3300025939 Bacteria 1151
75 Ga0207665_11423937 3300025939 Bacteria 551
76 Ga0207702_10084205 3300026078 Bacteria 2768
77 Ga0265338_10049451 3300028800 Bacteria 3811
78 Ga0265332_10160331 3300031238 Bacteria 940
79 Ga0265340_10026246 3300031247 Bacteria 2946
80 Ga0307416_101492008 3300032002 Bacteria 782
81 Ga0307416_102790203 3300032002 Bacteria 584
82 Ga0373940_0078742 3300035088 Bacteria 971
83 Ga0373944_0186165 3300035089 Bacteria 746
84 Ga0373923_0096964 3300035111 Bacteria 1296
85 Ga0373936_0529807 3300035113 Bacteria 549
86 Ga0373945_0093457 3300035116 Bacteria 1168
87 Ga0373953_0003088 3300035117 Bacteria 5120
88 Ga0373956_0307424 3300035119 Bacteria 755
89 Ga0373943_0026036 3300035170 Bacteria 2738
90 Ga0373946_0002546 3300035171 Bacteria 6446
91 Ga0373946_0262959 3300035171 Bacteria 845
92 Ga0373955_0030746 3300035172 Bacteria 2807
93 Ga0373955_0221458 3300035172 Bacteria 1130
94 Ga0373931_0176271 3300035691 Bacteria 1263
95 Ga0373935_0093608 3300035692 Bacteria 1971
96 Ga0373935_0455081 3300035692 Bacteria 925
97 Ga0373927_0466670 3300035695 Bacteria 834
98 Ga0373933_0274475 3300035724 Bacteria 1088
99 Ga0373947_0099990 3300035725 Bacteria 1821
100 Ga0373937_0005271 3300036401 Bacteria 11041
101 Ga0373925_0459309 3300037068 Bacteria 1043
102 Ga0395905_0265013 3300037471 Bacteria 1604
103 Ga0395905_0723186 3300037471 Unclassified 898
104 Ga0395901_1106811 3300038443 Unclassified 762
105 Ga0436365_1002922 3300039437 Bacteria 2302
106 Ga0436365_1839808 3300039437 Bacteria 6663
107 Ga0436363_1636959 3300039450 Bacteria 4964
108 Ga0436362_0624327 3300039453 Bacteria 1356
109 Ga0451802_1002908 3300041460 Bacteria 518
110 Ga0451576_0001200 3300045051 Bacteria 46344
111 Ga0495651_0196681 3300046462 Bacteria 1414
112 Ga0495580_0386808 3300046472 Bacteria 944
113 Ga0495628_0700760 3300046516 Bacteria 715
114 Ga0495658_0125408 3300046683 Bacteria 1557
115 Ga0495649_0129499 3300046694 Bacteria 1332
116 Ga0495604_0777799 3300047317 Bacteria 604
117 Ga0495674_1093775 3300047319 Bacteria 607
118 Ga0495679_062441 3300047446 Bacteria 1090
119 Ga0495684_0199893 3300047471 Unclassified 1474
120 Ga0495684_0344442 3300047471 Bacteria 1060
121 Ga0495593_0188034 3300047673 Unclassified 1039
122 Ga0495602_0339577 3300048088 Bacteria 1087
123 Ga0496104_0544141 3300048907 Bacteria 1072
124 Ga0496105_0883137 3300048908 Unclassified 675
125 Ga0496108_0321218 3300048911 Bacteria 1350
126 Ga0496110_0049194 3300048913 Bacteria 3697
127 Ga0496110_0145995 3300048913 Bacteria 2140
128 Ga0496112_1021312 3300048915 Bacteria 746
129 Ga0496112_1803153 3300048915 Bacteria 524
130 Ga0496114_0423675 3300048917 Bacteria 1179
131 Ga0496115_0664724 3300048918 Bacteria 822
132 Ga0496126_0000778 3300048929 Bacteria 57576
133 Ga0501034_1421086 3300049571 Bacteria 569
134 Ga0501034_1542305 3300049571 Bacteria 538
135 Ga0501036_0707837 3300049572 Bacteria 832
136 Ga0501038_0307938 3300049574 Bacteria 1242
137 Ga0501039_0578142 3300049575 Bacteria 881
138 Ga0501040_0180044 3300049576 Bacteria 1498
139 Ga0501040_1002159 3300049576 Bacteria 606
140 Ga0501041_0622369 3300049577 Unclassified 689
141 Ga0501042_0348723 3300049578 Bacteria 1071
142 Ga0501042_1055985 3300049578 Bacteria 592
143 Ga0501048_0513601 3300049582 Bacteria 859
144 Ga0501067_0000224 3300049583 Bacteria 31442
145 Ga0501071_0388761 3300049587 Bacteria 1064
146 Ga0501072_1008044 3300049588 Bacteria 649
147 Ga0501073_0110768 3300049589 Bacteria 1904
148 Ga0501074_0816879 3300049590 Bacteria 657
149 Ga0501074_1143376 3300049590 Bacteria 546
150 Ga0501075_0140526 3300049591 Bacteria 1840
151 Ga0501076_0051295 3300049592 Bacteria 3266
152 Ga0501076_0086737 3300049592 Bacteria 2516
153 Ga0501077_0174984 3300049593 Bacteria 1364
154 Ga0501080_0726387 3300049742 Bacteria 875
155 Ga0501080_1462452 3300049742 Bacteria 582
156 Ga0501083_0159546 3300049744 Bacteria 1475
157 Ga0501083_0495383 3300049744 Bacteria 795
158 Ga0501083_0599222 3300049744 Bacteria 717
159 Ga0501083_0773309 3300049744 Bacteria 625
160 nmdc:mga0yw44_136269_c1 3300050492 Bacteria 1593
161 nmdc:mga0yw44_773868_c1 3300050492 Bacteria 652
162 nmdc:mga07m45_140305_c1 3300050496 Bacteria 1399
163 nmdc:mga0qj67_483591_c1 3300050509 Bacteria 996
164 nmdc:mga0n895_486122_c1 3300050512 Bacteria 1245
165 nmdc:mga0rr50_1014800_c1 3300050513 Bacteria 707
166 nmdc:mga0rr50_115447_c1 3300050513 Bacteria 2130
167 nmdc:mga08x19_469406_c1 3300050514 Bacteria 887
168 nmdc:mga08x19_980853_c1 3300050514 Bacteria 600
169 Ga0495601_0561226 3300053077 Bacteria 734
170 Ga0495595_0525894 3300053084 Unclassified 603
171 Ga0495619_0188772 3300053085 Bacteria 1426
172 Ga0501084_0028005 3300054114 Bacteria 4708
173 Ga0501084_0099191 3300054114 Bacteria 2446
174 Ga0501084_0171585 3300054114 Bacteria 1831
175 Ga0501082_0011332 3300060353 Bacteria 7664
176 Ga0501082_0758661 3300060353 Bacteria 849
177 Ga0501082_0913587 3300060353 Bacteria 768
178 Ga0501082_1659462 3300060353 Bacteria 558
179 Ga0530510_0034115 3300061734 Bacteria 3665
180 Ga0530510_0049368 3300061734 Bacteria 3041
181 Ga0530510_0593130 3300061734 Bacteria 842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0726387 Ga0501080_0726387_217_588 87
2 3300049571 Ga0501034_1542305 Ga0501034_1542305_11_346 101
3 iso_pu_bacteria 2597489875 2597814567 102
4 iso_pu_bacteria 2856342000 2856348236 102
5 iso_pu_bacteria 2888343758 2888348089 102
6 iso_pu_bacteria 2970524798 2970531990 102
7 iso_pu_bacteria 2970540015 2970545922 102
8 3300005434 Ga0070709_10482503 Ga0070709_104825031 104
9 3300005434 Ga0070709_10310874 Ga0070709_103108741 105
10 3300005435 Ga0070714_101099993 Ga0070714_1010999932 105
11 3300005435 Ga0070714_102226494 Ga0070714_1022264942 105
12 3300005436 Ga0070713_100367625 Ga0070713_1003676252 105
13 3300005436 Ga0070713_100408377 Ga0070713_1004083772 105
14 3300005614 Ga0068856_100399922 Ga0068856_1003999222 105
15 3300005614 Ga0068856_100690046 Ga0068856_1006900462 105
16 3300006028 Ga0070717_10734397 Ga0070717_107343972 105
17 3300006173 Ga0070716_100771646 Ga0070716_1007716462 105
18 3300006175 Ga0070712_101564688 Ga0070712_1015646882 105
19 3300006914 Ga0075436_100050491 Ga0075436_1000504913 105
20 3300007076 Ga0075435_101201199 Ga0075435_1012011992 105
21 3300007788 Ga0099795_10009005 Ga0099795_100090052 105
22 3300010159 Ga0099796_10000638 Ga0099796_100006383 105
23 3300014497 Ga0182008_10031326 Ga0182008_100313262 105
24 3300021358 Ga0213873_10033027 Ga0213873_100330272 105
25 3300021384 Ga0213876_10029875 Ga0213876_100298752 105
26 3300021384 Ga0213876_10429831 Ga0213876_104298311 105
27 3300025898 Ga0207692_10149089 Ga0207692_101490892 105
28 3300025915 Ga0207693_10297691 Ga0207693_102976912 105
29 3300025915 Ga0207693_10496080 Ga0207693_104960803 105
30 3300025916 Ga0207663_10532707 Ga0207663_105327072 105
31 3300025928 Ga0207700_10034926 Ga0207700_100349262 105
32 3300025928 Ga0207700_11597266 Ga0207700_115972661 105
33 3300025929 Ga0207664_11246807 Ga0207664_112468071 105
34 3300025931 Ga0207644_10465600 Ga0207644_104656002 105
35 3300025939 Ga0207665_10327378 Ga0207665_103273782 105
36 3300026078 Ga0207702_10084205 Ga0207702_100842052 105
37 3300035088 Ga0373940_0078742 Ga0373940_0078742_547_864 105
38 3300035089 Ga0373944_0186165 Ga0373944_0186165_75_392 105
39 3300035116 Ga0373945_0093457 Ga0373945_0093457_192_509 105
40 3300035170 Ga0373943_0026036 Ga0373943_0026036_591_908 105
41 3300035171 Ga0373946_0262959 Ga0373946_0262959_93_410 105
42 3300035691 Ga0373931_0176271 Ga0373931_0176271_553_870 105
43 3300035692 Ga0373935_0455081 Ga0373935_0455081_49_366 105
44 3300035695 Ga0373927_0466670 Ga0373927_0466670_287_604 105
45 3300035725 Ga0373947_0099990 Ga0373947_0099990_1108_1425 105
46 3300037068 Ga0373925_0459309 Ga0373925_0459309_129_446 105
47 3300039437 Ga0436365_1002922 Ga0436365_1002922_952_1269 105
48 3300039437 Ga0436365_1839808 Ga0436365_1839808_2331_2648 105
49 3300039453 Ga0436362_0624327 Ga0436362_0624327_236_553 105
50 3300046472 Ga0495580_0386808 Ga0495580_0386808_124_441 105
51 3300048907 Ga0496104_0544141 Ga0496104_0544141_353_670 105
52 3300048908 Ga0496105_0883137 Ga0496105_0883137_181_498 105
53 3300048911 Ga0496108_0321218 Ga0496108_0321218_109_426 105
54 3300048913 Ga0496110_0145995 Ga0496110_0145995_1380_1697 105
55 3300048915 Ga0496112_1021312 Ga0496112_1021312_346_663 105
56 3300050513 nmdc:mga0rr50_1014800_c1 nmdc:mga0rr50_1014800_c1_173_490 105
57 3300050514 nmdc:mga08x19_469406_c1 nmdc:mga08x19_469406_c1_48_365 105
58 3300050514 nmdc:mga08x19_980853_c1 nmdc:mga08x19_980853_c1_257_574 105
59 3300005434 Ga0070709_10793559 Ga0070709_107935591 106
60 3300006173 Ga0070716_101643078 Ga0070716_1016430781 106
61 3300006175 Ga0070712_100575064 Ga0070712_1005750642 106
62 3300046462 Ga0495651_0196681 Ga0495651_0196681_838_1158 106
63 3300048088 Ga0495602_0339577 Ga0495602_0339577_265_585 106
64 3300049572 Ga0501036_0707837 Ga0501036_0707837_288_608 106
65 3300005435 Ga0070714_100443278 Ga0070714_1004432782 107
66 3300005436 Ga0070713_100079111 Ga0070713_1000791112 107
67 3300005436 Ga0070713_100381349 Ga0070713_1003813492 107
68 3300005437 Ga0070710_10105896 Ga0070710_101058962 107
69 3300005439 Ga0070711_101517548 Ga0070711_1015175481 107
70 3300005467 Ga0070706_100464437 Ga0070706_1004644372 107
71 3300005518 Ga0070699_100023172 Ga0070699_1000231724 107
72 3300005719 Ga0068861_102206722 Ga0068861_1022067222 107
73 3300005937 Ga0081455_10154662 Ga0081455_101546622 107
74 3300005937 Ga0081455_10442170 Ga0081455_104421702 107
75 3300005983 Ga0081540_1017584 Ga0081540_10175844 107
76 3300005983 Ga0081540_1080404 Ga0081540_10804041 107
77 3300006028 Ga0070717_10467422 Ga0070717_104674222 107
78 3300006048 Ga0075363_100557431 Ga0075363_1005574312 107
79 3300006051 Ga0075364_10612266 Ga0075364_106122662 107
80 3300006175 Ga0070712_100013128 Ga0070712_1000131283 107
81 3300006175 Ga0070712_100523161 Ga0070712_1005231612 107
82 3300006177 Ga0075362_10574680 Ga0075362_105746802 107
83 3300006844 Ga0075428_100151357 Ga0075428_1001513572 107
84 3300006844 Ga0075428_102435426 Ga0075428_1024354261 107
85 3300006847 Ga0075431_100736233 Ga0075431_1007362332 107
86 3300006852 Ga0075433_10779687 Ga0075433_107796872 107
87 3300006914 Ga0075436_100484831 Ga0075436_1004848311 107
88 3300007076 Ga0075435_100049683 Ga0075435_1000496832 107
89 3300009147 Ga0114129_10114486 Ga0114129_101144862 107
90 3300009147 Ga0114129_10399460 Ga0114129_103994602 107
91 3300025898 Ga0207692_10099456 Ga0207692_100994562 107
92 3300025915 Ga0207693_10046710 Ga0207693_100467103 107
93 3300025915 Ga0207693_10570716 Ga0207693_105707162 107
94 3300025915 Ga0207693_10644095 Ga0207693_106440952 107
95 3300025916 Ga0207663_10404581 Ga0207663_104045812 107
96 3300025928 Ga0207700_10242349 Ga0207700_102423491 107
97 3300025928 Ga0207700_11496172 Ga0207700_114961722 107
98 3300025929 Ga0207664_10399387 Ga0207664_103993871 107
99 3300025939 Ga0207665_11423937 Ga0207665_114239372 107
100 3300028800 Ga0265338_10049451 Ga0265338_100494515 107
101 3300031238 Ga0265332_10160331 Ga0265332_101603312 107
102 3300031247 Ga0265340_10026246 Ga0265340_100262462 107
103 3300032002 Ga0307416_101492008 Ga0307416_1014920082 107
104 3300032002 Ga0307416_102790203 Ga0307416_1027902031 107
105 3300035111 Ga0373923_0096964 Ga0373923_0096964_908_1231 107
106 3300035113 Ga0373936_0529807 Ga0373936_0529807_49_372 107
107 3300035117 Ga0373953_0003088 Ga0373953_0003088_3630_3953 107
108 3300035171 Ga0373946_0002546 Ga0373946_0002546_1406_1729 107
109 3300035172 Ga0373955_0030746 Ga0373955_0030746_735_1058 107
110 3300035172 Ga0373955_0221458 Ga0373955_0221458_793_1116 107
111 3300035692 Ga0373935_0093608 Ga0373935_0093608_937_1260 107
112 3300035724 Ga0373933_0274475 Ga0373933_0274475_557_880 107
113 3300036401 Ga0373937_0005271 Ga0373937_0005271_10662_10985 107
114 3300037471 Ga0395905_0265013 Ga0395905_0265013_938_1261 107
115 3300039450 Ga0436363_1636959 Ga0436363_1636959_489_812 107
116 3300041460 Ga0451802_1002908 Ga0451802_1002908_161_484 107
117 3300046516 Ga0495628_0700760 Ga0495628_0700760_91_414 107
118 3300046683 Ga0495658_0125408 Ga0495658_0125408_24_347 107
119 3300046694 Ga0495649_0129499 Ga0495649_0129499_940_1263 107
120 3300047317 Ga0495604_0777799 Ga0495604_0777799_154_477 107
121 3300047319 Ga0495674_1093775 Ga0495674_1093775_41_364 107
122 3300047446 Ga0495679_062441 Ga0495679_062441_714_1037 107
123 3300047471 Ga0495684_0199893 Ga0495684_0199893_794_1117 107
124 3300047471 Ga0495684_0344442 Ga0495684_0344442_479_802 107
125 3300047673 Ga0495593_0188034 Ga0495593_0188034_689_1012 107
126 3300048915 Ga0496112_1803153 Ga0496112_1803153_163_486 107
127 3300048917 Ga0496114_0423675 Ga0496114_0423675_434_757 107
128 3300048918 Ga0496115_0664724 Ga0496115_0664724_23_346 107
129 3300048929 Ga0496126_0000778 Ga0496126_0000778_56261_56584 107
130 3300049571 Ga0501034_1421086 Ga0501034_1421086_28_351 107
131 3300049574 Ga0501038_0307938 Ga0501038_0307938_568_891 107
132 3300049575 Ga0501039_0578142 Ga0501039_0578142_508_831 107
133 3300049576 Ga0501040_0180044 Ga0501040_0180044_895_1218 107
134 3300049576 Ga0501040_1002159 Ga0501040_1002159_68_391 107
135 3300049577 Ga0501041_0622369 Ga0501041_0622369_173_496 107
136 3300049578 Ga0501042_0348723 Ga0501042_0348723_490_813 107
137 3300049578 Ga0501042_1055985 Ga0501042_1055985_37_360 107
138 3300049582 Ga0501048_0513601 Ga0501048_0513601_21_344 107
139 3300049583 Ga0501067_0000224 Ga0501067_0000224_18899_19222 107
140 3300049587 Ga0501071_0388761 Ga0501071_0388761_361_684 107
141 3300049588 Ga0501072_1008044 Ga0501072_1008044_243_566 107
142 3300049589 Ga0501073_0110768 Ga0501073_0110768_162_485 107
143 3300049590 Ga0501074_0816879 Ga0501074_0816879_263_586 107
144 3300049590 Ga0501074_1143376 Ga0501074_1143376_142_465 107
145 3300049591 Ga0501075_0140526 Ga0501075_0140526_677_1000 107
146 3300049592 Ga0501076_0051295 Ga0501076_0051295_1885_2208 107
147 3300049592 Ga0501076_0086737 Ga0501076_0086737_606_929 107
148 3300049593 Ga0501077_0174984 Ga0501077_0174984_135_458 107
149 3300049742 Ga0501080_1462452 Ga0501080_1462452_199_522 107
150 3300049744 Ga0501083_0159546 Ga0501083_0159546_494_817 107
151 3300049744 Ga0501083_0599222 Ga0501083_0599222_264_587 107
152 3300049744 Ga0501083_0773309 Ga0501083_0773309_64_390 107
153 3300050492 nmdc:mga0yw44_136269_c1 nmdc:mga0yw44_136269_c1_466_789 107
154 3300050492 nmdc:mga0yw44_773868_c1 nmdc:mga0yw44_773868_c1_50_373 107
155 3300050496 nmdc:mga07m45_140305_c1 nmdc:mga07m45_140305_c1_58_381 107
156 3300050509 nmdc:mga0qj67_483591_c1 nmdc:mga0qj67_483591_c1_162_485 107
157 3300050512 nmdc:mga0n895_486122_c1 nmdc:mga0n895_486122_c1_502_840 107
158 3300050513 nmdc:mga0rr50_115447_c1 nmdc:mga0rr50_115447_c1_1728_2066 107
159 3300053077 Ga0495601_0561226 Ga0495601_0561226_388_711 107
160 3300053084 Ga0495595_0525894 Ga0495595_0525894_256_579 107
161 3300053085 Ga0495619_0188772 Ga0495619_0188772_44_367 107
162 3300054114 Ga0501084_0028005 Ga0501084_0028005_3543_3866 107
163 3300054114 Ga0501084_0099191 Ga0501084_0099191_1202_1525 107
164 3300060353 Ga0501082_0011332 Ga0501082_0011332_620_943 107
165 3300060353 Ga0501082_0913587 Ga0501082_0913587_47_370 107
166 3300061734 Ga0530510_0034115 Ga0530510_0034115_3307_3630 107
167 3300061734 Ga0530510_0049368 Ga0530510_0049368_784_1107 107
168 3300005295 Ga0065707_11139099 Ga0065707_111390991 108
169 3300005436 Ga0070713_100227417 Ga0070713_1002274171 108
170 3300005546 Ga0070696_100030227 Ga0070696_1000302274 108
171 3300005981 Ga0081538_10015393 Ga0081538_100153936 108
172 3300006028 Ga0070717_10427966 Ga0070717_104279661 108
173 3300006175 Ga0070712_100025647 Ga0070712_1000256471 108
174 3300025915 Ga0207693_10013560 Ga0207693_100135605 108
175 3300025928 Ga0207700_10229898 Ga0207700_102298982 108
176 3300035119 Ga0373956_0307424 Ga0373956_0307424_88_480 108
177 3300037471 Ga0395905_0723186 Ga0395905_0723186_344_670 108
178 3300038443 Ga0395901_1106811 Ga0395901_1106811_363_689 108
179 3300048913 Ga0496110_0049194 Ga0496110_0049194_501_866 108
180 3300049744 Ga0501083_0495383 Ga0501083_0495383_73_399 108
181 3300054114 Ga0501084_0171585 Ga0501084_0171585_685_1056 108
182 3300060353 Ga0501082_0758661 Ga0501082_0758661_238_603 108
183 3300060353 Ga0501082_1659462 Ga0501082_1659462_17_343 108
184 3300061734 Ga0530510_0593130 Ga0530510_0593130_132_503 108
185 3300003320 rootH2_10000846 rootH2_100008462 109
186 3300045051 Ga0451576_0001200 Ga0451576_0001200_18040_18384 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07345

ATPaseInh_sub_z

ATPase inhibitor subunit zeta

17

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kzc-assembly1.cif.gz_A solution nmr structure of the protein yp_510488.1 0.8984 22 107
2kzc-assembly1.cif.gz_A solution nmr structure of the protein yp_510488.1 0.8692 22 107
2ll0-assembly1.cif.gz_A nmr structure of the putative atpase regulatory protein yp_916642.1 from paracoccus denitrificans 0.7624 8 107
2ll0-assembly1.cif.gz_A nmr structure of the putative atpase regulatory protein yp_916642.1 from paracoccus denitrificans 0.7101 8 107
7vkv-assembly1.cif.gz_X nmr structure of the zeta-subunit of the f1f0-atpase from sinorhizobium meliloti 0.6398 7 103
ID Description Score Start End Superfamily
2kzcA00 Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Domain of unknown function DUF1476 0.8984 22 107 1.10.790.20
2kzcA00 Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Domain of unknown function DUF1476 0.8692 22 107 1.10.790.20
1rfmA01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.7875 28 81 1.10.1530.10
2ll0A00 Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Domain of unknown function DUF1476 0.7624 8 107 1.10.790.20
2ll0A00 Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Domain of unknown function DUF1476 0.7101 8 107 1.10.790.20
ID Description Score Start End GO Terms
AF-A0A7C5Q216-F1-model_v4 DUF1476 domain-containing protein 0.9733 29 108
AF-A0A2A5GC89-F1-model_v4 DUF1476 domain-containing protein 0.9679 26 106
AF-A0A522X4D0-F1-model_v4 DUF1476 family protein 0.967 19 102
AF-A0A382JR19-F1-model_v4 DUF1476 domain-containing protein 0.9665 23 103
AF-W9GZ86-F1-model_v4 Aldolase 0.9603 20 106

Feature Viewer

pLDDT pTM Quality
81.88 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map