F285679

General Info

Members Datasets Scaffolds Average Seq Length
186 103 372 208

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100064247|Ga0068855_1000642475
Length 231
Sequence MQRAYVVRSLECMLFSRAKSQLVDADRALRGRDHYEFEVPDKHFVTGRPIKPPFPDGLKQAVFGAGCFWGVEEIFWDEPGVWTTAVGYTGGYTPHPDYEEVCSGLTGHTEAILVVYDPKQTTFENLVAKFFEVHDPTQGYRQGNDVGTQYRSGIYYTDDEQRAVAERAKKLFGEELADRGYGAITTEVAPVGEFFYAEGYHQQYLAKNPNGYRCHSTTGLTFPRAKLDGVA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
42 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
43 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
44 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
59 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
62 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
63 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
103 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.09
Metatranscriptomes 5.38
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 5.38
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100064247 3300005563 Bacteria 4280
2 JGI24737J22298_10061676 3300001990 Bacteria 1127
3 JGI25407J50210_10002941 3300003373 Bacteria 4064
4 Ga0070683_100096599 3300005329 Bacteria 2779
5 Ga0068867_100704709 3300005459 Bacteria 891
6 Ga0070665_100523962 3300005548 Bacteria 1197
7 Ga0068855_100106090 3300005563 Bacteria 3229
8 Ga0068856_100359181 3300005614 Bacteria 1475
9 Ga0068852_100894831 3300005616 Bacteria 905
10 Ga0068859_100007117 3300005617 Bacteria 11354
11 Ga0081455_10031904 3300005937 Bacteria 4756
12 Ga0081538_10001139 3300005981 Bacteria 28067
13 Ga0075364_10011186 3300006051 Bacteria 5446
14 Ga0075428_101306592 3300006844 Bacteria 763
15 Ga0075430_100026064 3300006846 Bacteria 4974
16 Ga0097620_100007116 3300006931 Bacteria 11354
17 Ga0105247_10001225 3300009101 Bacteria 19051
18 Ga0105237_10156765 3300009545 Bacteria 2274
19 Ga0105239_10618015 3300010375 Bacteria 1236
20 Ga0105239_10647511 3300010375 Bacteria 1207
21 Ga0157371_10546061 3300013102 Bacteria 859
22 Ga0157369_10918302 3300013105 Bacteria 897
23 Ga0157380_10008729 3300014326 Bacteria 7242
24 Ga0197907_10516819 3300020069 Bacteria 2092
25 Ga0206351_10093761 3300020077 Bacteria 3177
26 Ga0206351_10835571 3300020077 Bacteria 1369
27 Ga0206350_10954584 3300020080 Bacteria 1254
28 Ga0206354_11173873 3300020081 Bacteria 967
29 Ga0206353_11124881 3300020082 Bacteria 920
30 Ga0206353_11540733 3300020082 Bacteria 3518
31 Ga0206353_11664162 3300020082 Bacteria 913
32 Ga0154015_1264582 3300020610 Bacteria 958
33 Ga0209025_1116259 3300025294 Bacteria 809
34 Ga0207710_10074458 3300025900 Bacteria 1563
35 Ga0207647_10023628 3300025904 Bacteria 4063
36 Ga0207647_10031613 3300025904 Bacteria 3405
37 Ga0207705_10871197 3300025909 Bacteria 698
38 Ga0207695_10436772 3300025913 Bacteria 1193
39 Ga0207671_10152151 3300025914 Bacteria 1788
40 Ga0207661_10096788 3300025944 Bacteria 2470
41 Ga0207667_10029311 3300025949 Bacteria 5970
42 Ga0207648_10062635 3300026089 Bacteria 3242
43 Ga0207698_10513980 3300026142 Bacteria 1168
44 Ga0268266_10239844 3300028379 Bacteria 1673
45 Ga0265327_10000001 3300031251 Bacteria 894475
46 Ga0265313_10002183 3300031595 Bacteria 17328
47 Ga0451789_0167637 3300041443 Bacteria 2353
48 Ga0451793_0456736 3300041452 Bacteria 2956
49 Ga0451800_0221779 3300041459 Bacteria 1885
50 Ga0466969_0150537 3300044656 Bacteria 1072
51 Ga0466972_0011329 3300044658 Bacteria 4474
52 Ga0466966_0011038 3300044684 Bacteria 5997
53 Ga0466966_0015390 3300044684 Bacteria 5057
54 Ga0466966_0095738 3300044684 Bacteria 1839
55 Ga0466966_0300629 3300044684 Bacteria 964
56 Ga0466966_0348632 3300044684 Bacteria 890
57 Ga0466961_0027175 3300044693 Bacteria 3679
58 Ga0466961_0029086 3300044693 Bacteria 3553
59 Ga0466961_0044410 3300044693 Bacteria 2843
60 Ga0466961_0322815 3300044693 Bacteria 941
61 Ga0466961_0513182 3300044693 Bacteria 723
62 Ga0466963_0004873 3300044694 Bacteria 7822
63 Ga0466963_0015374 3300044694 Bacteria 4737
64 Ga0466963_0096849 3300044694 Bacteria 2015
65 Ga0466963_0259517 3300044694 Bacteria 1220
66 Ga0466963_0415765 3300044694 Bacteria 948
67 Ga0466963_0783580 3300044694 Bacteria 672
68 Ga0466964_0006163 3300044706 Bacteria 4468
69 Ga0466964_0049213 3300044706 Bacteria 1725
70 Ga0466971_0012229 3300044719 Bacteria 3759
71 Ga0466971_0083933 3300044719 Bacteria 1454
72 Ga0466971_0093486 3300044719 Bacteria 1378
73 Ga0466971_0097874 3300044719 Bacteria 1346
74 Ga0466970_0002714 3300044765 Bacteria 8550
75 Ga0466970_0203457 3300044765 Bacteria 1102
76 Ga0466957_0004627 3300044842 Bacteria 7687
77 Ga0466957_0034037 3300044842 Bacteria 3056
78 Ga0466957_0155966 3300044842 Bacteria 1480
79 Ga0466959_0025498 3300045049 Bacteria 4382
80 Ga0466959_0037386 3300045049 Bacteria 3587
81 Ga0466959_0096229 3300045049 Bacteria 2123
82 Ga0466959_0108032 3300045049 Bacteria 1988
83 Ga0466959_0108570 3300045049 Bacteria 1982
84 Ga0466959_0187170 3300045049 Bacteria 1446
85 Ga0466959_0235727 3300045049 Bacteria 1265
86 Ga0466959_0273957 3300045049 Bacteria 1159
87 Ga0466958_0012628 3300045836 Bacteria 4787
88 Ga0466958_0015607 3300045836 Bacteria 4356
89 Ga0466958_0020257 3300045836 Bacteria 3877
90 Ga0466958_0020766 3300045836 Bacteria 3833
91 Ga0466958_0065946 3300045836 Bacteria 2210
92 Ga0466958_0073005 3300045836 Bacteria 2102
93 Ga0466958_0120990 3300045836 Bacteria 1639
94 Ga0466958_0388715 3300045836 Bacteria 900
95 Ga0466967_0001172 3300045976 Bacteria 14721
96 Ga0466967_0004064 3300045976 Bacteria 9766
97 Ga0466967_0006820 3300045976 Bacteria 8142
98 Ga0466967_0011269 3300045976 Bacteria 6758
99 Ga0466967_0019427 3300045976 Bacteria 5462
100 Ga0466967_0020127 3300045976 Bacteria 5384
101 Ga0466967_0034630 3300045976 Bacteria 4289
102 Ga0466967_0264129 3300045976 Bacteria 1647
103 Ga0466967_0295410 3300045976 Bacteria 1557
104 Ga0495658_0019641 3300046683 Bacteria 3530
105 Ga0496101_0017014 3300048904 Bacteria 4924
106 Ga0496102_0000013 3300048905 Bacteria 311668
107 Ga0496102_0003518 3300048905 Bacteria 13272
108 Ga0496103_0000105 3300048906 Bacteria 92467
109 Ga0496103_0003041 3300048906 Bacteria 10321
110 Ga0496103_0059779 3300048906 Bacteria 2368
111 Ga0496108_0392617 3300048911 Bacteria 1212
112 Ga0496118_0005657 3300048921 Bacteria 14093
113 Ga0496119_0000756 3300048922 Bacteria 43352
114 Ga0496120_0001889 3300048923 Bacteria 23265
115 Ga0496121_0137612 3300048924 Bacteria 1817
116 Ga0501321_015065 3300049537 Bacteria 906
117 Ga0501031_0013776 3300049568 Bacteria 5271
118 Ga0501031_0046092 3300049568 Bacteria 2844
119 Ga0501032_0013885 3300049569 Bacteria 5714
120 Ga0501032_0029694 3300049569 Bacteria 3750
121 Ga0501032_0178541 3300049569 Bacteria 1391
122 Ga0501033_0166835 3300049570 Bacteria 1583
123 Ga0501033_0243888 3300049570 Bacteria 1274
124 Ga0501034_0068697 3300049571 Bacteria 3554
125 Ga0501034_0132860 3300049571 Bacteria 2472
126 Ga0501034_0423724 3300049571 Bacteria 1252
127 Ga0501034_0840138 3300049571 Bacteria 809
128 Ga0501036_0183819 3300049572 Bacteria 1759
129 Ga0501036_0577727 3300049572 Bacteria 933
130 Ga0501036_1008014 3300049572 Unclassified 682
131 Ga0501037_0153739 3300049573 Bacteria 1643
132 Ga0501037_0169855 3300049573 Bacteria 1551
133 Ga0501037_0378609 3300049573 Bacteria 973
134 Ga0501038_0001226 3300049574 Bacteria 23248
135 Ga0501038_0084702 3300049574 Bacteria 2667
136 Ga0501038_0722573 3300049574 Bacteria 745
137 Ga0501039_0182644 3300049575 Bacteria 1649
138 Ga0501039_0239251 3300049575 Bacteria 1427
139 Ga0501040_0115393 3300049576 Bacteria 1880
140 Ga0501040_0428789 3300049576 Bacteria 951
141 Ga0501041_0099027 3300049577 Bacteria 1803
142 Ga0501041_0433084 3300049577 Bacteria 834
143 Ga0501042_0247443 3300049578 Bacteria 1286
144 Ga0501043_0283068 3300049579 Bacteria 1271
145 Ga0501043_0867877 3300049579 Bacteria 649
146 Ga0501046_0067027 3300049580 Bacteria 2796
147 Ga0501046_0313770 3300049580 Bacteria 1143
148 Ga0501046_0480507 3300049580 Bacteria 891
149 Ga0501047_0002035 3300049581 Bacteria 19329
150 Ga0501047_0341484 3300049581 Bacteria 1335
151 Ga0501048_0000749 3300049582 Bacteria 23801
152 Ga0501067_0101590 3300049583 Bacteria 1598
153 Ga0501067_0414745 3300049583 Bacteria 751
154 Ga0501068_0301782 3300049584 Bacteria 1025
155 Ga0501070_0007815 3300049586 Bacteria 9066
156 Ga0501071_0128831 3300049587 Bacteria 1879
157 Ga0501072_0256467 3300049588 Bacteria 1392
158 Ga0501072_0759243 3300049588 Bacteria 760
159 Ga0501073_0421574 3300049589 Bacteria 922
160 Ga0501074_0165472 3300049590 Bacteria 1579
161 Ga0501074_0184198 3300049590 Bacteria 1489
162 Ga0501077_0052708 3300049593 Bacteria 2583
163 Ga0501077_0218754 3300049593 Bacteria 1210
164 Ga0501079_0013277 3300049741 Bacteria 6280
165 Ga0501080_0190825 3300049742 Bacteria 1883
166 Ga0501080_0462030 3300049742 Bacteria 1137
167 Ga0501081_0090582 3300049743 Bacteria 2150
168 Ga0501035_0007201 3300049822 Bacteria 10411
169 Ga0501035_0528689 3300049822 Bacteria 968
170 Ga0501044_0074010 3300049823 Bacteria 3462
171 Ga0501044_0249310 3300049823 Bacteria 1717
172 Ga0501045_0013974 3300049824 Bacteria 5682
173 Ga0501045_0477349 3300049824 Bacteria 926
174 nmdc:mga09592_373335_c1 3300050508 Bacteria 1234
175 nmdc:mga0qj67_79143_c1 3300050509 Bacteria 2632
176 nmdc:mga06r32_130846_c1 3300050510 Bacteria 2482
177 nmdc:mga08y16_151356_c1 3300050511 Bacteria 2412
178 nmdc:mga08y16_781550_c1 3300050511 Bacteria 949
179 Ga0501084_0128665 3300054114 Bacteria 2131
180 Ga0501082_0202882 3300060353 Bacteria 1725
181 Ga0501082_0891052 3300060353 Bacteria 778
182 Ga0466962_0006535 3300061719 Bacteria 5597
183 Ga0466962_0013008 3300061719 Bacteria 4003
184 Ga0466962_0236472 3300061719 Bacteria 896
185 Ga0530510_0152366 3300061734 Bacteria 1707
186 2644000505 2643221598 Bacteria 4578346
187 Ga0068855_100064247
188 JGI24737J22298_10061676
189 JGI25407J50210_10002941
190 Ga0070683_100096599
191 Ga0068867_100704709
192 Ga0070665_100523962
193 Ga0068855_100106090
194 Ga0068856_100359181
195 Ga0068852_100894831
196 Ga0068859_100007117
197 Ga0081455_10031904
198 Ga0081538_10001139
199 Ga0075364_10011186
200 Ga0075428_101306592
201 Ga0075430_100026064
202 Ga0097620_100007116
203 Ga0105247_10001225
204 Ga0105237_10156765
205 Ga0105239_10618015
206 Ga0105239_10647511
207 Ga0157371_10546061
208 Ga0157369_10918302
209 Ga0157380_10008729
210 Ga0197907_10516819
211 Ga0206351_10093761
212 Ga0206351_10835571
213 Ga0206350_10954584
214 Ga0206354_11173873
215 Ga0206353_11124881
216 Ga0206353_11540733
217 Ga0206353_11664162
218 Ga0154015_1264582
219 Ga0209025_1116259
220 Ga0207710_10074458
221 Ga0207647_10023628
222 Ga0207647_10031613
223 Ga0207705_10871197
224 Ga0207695_10436772
225 Ga0207671_10152151
226 Ga0207661_10096788
227 Ga0207667_10029311
228 Ga0207648_10062635
229 Ga0207698_10513980
230 Ga0268266_10239844
231 Ga0265327_10000001
232 Ga0265313_10002183
233 Ga0451789_0167637
234 Ga0451793_0456736
235 Ga0451800_0221779
236 Ga0466969_0150537
237 Ga0466972_0011329
238 Ga0466966_0011038
239 Ga0466966_0015390
240 Ga0466966_0095738
241 Ga0466966_0300629
242 Ga0466966_0348632
243 Ga0466961_0027175
244 Ga0466961_0029086
245 Ga0466961_0044410
246 Ga0466961_0322815
247 Ga0466961_0513182
248 Ga0466963_0004873
249 Ga0466963_0015374
250 Ga0466963_0096849
251 Ga0466963_0259517
252 Ga0466963_0415765
253 Ga0466963_0783580
254 Ga0466964_0006163
255 Ga0466964_0049213
256 Ga0466971_0012229
257 Ga0466971_0083933
258 Ga0466971_0093486
259 Ga0466971_0097874
260 Ga0466970_0002714
261 Ga0466970_0203457
262 Ga0466957_0004627
263 Ga0466957_0034037
264 Ga0466957_0155966
265 Ga0466959_0025498
266 Ga0466959_0037386
267 Ga0466959_0096229
268 Ga0466959_0108032
269 Ga0466959_0108570
270 Ga0466959_0187170
271 Ga0466959_0235727
272 Ga0466959_0273957
273 Ga0466958_0012628
274 Ga0466958_0015607
275 Ga0466958_0020257
276 Ga0466958_0020766
277 Ga0466958_0065946
278 Ga0466958_0073005
279 Ga0466958_0120990
280 Ga0466958_0388715
281 Ga0466967_0001172
282 Ga0466967_0004064
283 Ga0466967_0006820
284 Ga0466967_0011269
285 Ga0466967_0019427
286 Ga0466967_0020127
287 Ga0466967_0034630
288 Ga0466967_0264129
289 Ga0466967_0295410
290 Ga0495658_0019641
291 Ga0496101_0017014
292 Ga0496102_0000013
293 Ga0496102_0003518
294 Ga0496103_0000105
295 Ga0496103_0003041
296 Ga0496103_0059779
297 Ga0496108_0392617
298 Ga0496118_0005657
299 Ga0496119_0000756
300 Ga0496120_0001889
301 Ga0496121_0137612
302 Ga0501321_015065
303 Ga0501031_0013776
304 Ga0501031_0046092
305 Ga0501032_0013885
306 Ga0501032_0029694
307 Ga0501032_0178541
308 Ga0501033_0166835
309 Ga0501033_0243888
310 Ga0501034_0068697
311 Ga0501034_0132860
312 Ga0501034_0423724
313 Ga0501034_0840138
314 Ga0501036_0183819
315 Ga0501036_0577727
316 Ga0501036_1008014
317 Ga0501037_0153739
318 Ga0501037_0169855
319 Ga0501037_0378609
320 Ga0501038_0001226
321 Ga0501038_0084702
322 Ga0501038_0722573
323 Ga0501039_0182644
324 Ga0501039_0239251
325 Ga0501040_0115393
326 Ga0501040_0428789
327 Ga0501041_0099027
328 Ga0501041_0433084
329 Ga0501042_0247443
330 Ga0501043_0283068
331 Ga0501043_0867877
332 Ga0501046_0067027
333 Ga0501046_0313770
334 Ga0501046_0480507
335 Ga0501047_0002035
336 Ga0501047_0341484
337 Ga0501048_0000749
338 Ga0501067_0101590
339 Ga0501067_0414745
340 Ga0501068_0301782
341 Ga0501070_0007815
342 Ga0501071_0128831
343 Ga0501072_0256467
344 Ga0501072_0759243
345 Ga0501073_0421574
346 Ga0501074_0165472
347 Ga0501074_0184198
348 Ga0501077_0052708
349 Ga0501077_0218754
350 Ga0501079_0013277
351 Ga0501080_0190825
352 Ga0501080_0462030
353 Ga0501081_0090582
354 Ga0501035_0007201
355 Ga0501035_0528689
356 Ga0501044_0074010
357 Ga0501044_0249310
358 Ga0501045_0013974
359 Ga0501045_0477349
360 nmdc:mga09592_373335_c1
361 nmdc:mga0qj67_79143_c1
362 nmdc:mga06r32_130846_c1
363 nmdc:mga08y16_151356_c1
364 nmdc:mga08y16_781550_c1
365 Ga0501084_0128665
366 Ga0501082_0202882
367 Ga0501082_0891052
368 Ga0466962_0006535
369 Ga0466962_0013008
370 Ga0466962_0236472
371 Ga0530510_0152366
372 2644000505

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

60

215

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9821 9 202
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.982 10 214
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9772 10 214
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.977 9 202
1ff3-assembly2.cif.gz_B structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9656 10 198
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9729 50 198 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9703 49 201 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9656 10 198 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9535 50 198 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9373 50 208 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A3C1N8T3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9945 49 213 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A450UUA4-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9933 52 213 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A257NGS9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9926 52 213 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A318WPW0-F1-model_v4 deleted 0.992 34 194
AF-A0A354CAY5-F1-model_v4 deleted 0.9919 66 215

Map