F285610

General Info

Members Datasets Scaffolds Average Seq Length
186 118 372 213

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10448112|Ga0070681_104481122
Length 214
Sequence MSCGFDLDHYRELLEAAAAGGYRFAHFEAEPQAGSVYLRHDVDLSLEAALAMARLERELGASATYFLMTESVFYNLDSALGRDTLGELRDLGHAVGLHAVHPRAARGDDRFDAVLAWHNPEPSYVNDPVDGFLNVMQPPWFTKGRYRSDSNAHWREGCPHDELRAGAFAWLQLLVHPEIWVYPGATMGETMRAMAEAKTRELLEQLADDRIDLT

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 6.45
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 23.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10448112 3300005458 Bacteria 1203
2 Ga0070683_100184775 3300005329 Bacteria 1979
3 Ga0070683_100352054 3300005329 Bacteria 1402
4 Ga0070680_100018736 3300005336 Bacteria 5477
5 Ga0070680_100507718 3300005336 Unclassified 1032
6 Ga0070682_100005451 3300005337 Bacteria 7089
7 Ga0070660_100081915 3300005339 Bacteria 2533
8 Ga0070660_100764905 3300005339 Bacteria 811
9 Ga0070661_100067105 3300005344 Bacteria 2636
10 Ga0070659_100191267 3300005366 Bacteria 1682
11 Ga0070709_10375052 3300005434 Unclassified 1056
12 Ga0070714_100062625 3300005435 Bacteria 3197
13 Ga0070714_100098407 3300005435 Bacteria 2573
14 Ga0070714_100395791 3300005435 Unclassified 1305
15 Ga0070713_100065729 3300005436 Unclassified 3048
16 Ga0070713_100210291 3300005436 Bacteria 1761
17 Ga0070711_100057350 3300005439 Bacteria 2697
18 Ga0070681_10090231 3300005458 Bacteria 3015
19 Ga0070681_10556845 3300005458 Bacteria 1060
20 Ga0070706_100309677 3300005467 Bacteria 1473
21 Ga0070707_100746485 3300005468 Bacteria 942
22 Ga0070698_100041598 3300005471 Bacteria 4717
23 Ga0070679_100043387 3300005530 Bacteria 4479
24 Ga0070679_100107799 3300005530 Bacteria 2771
25 Ga0070679_100156549 3300005530 Bacteria 2253
26 Ga0070679_100542177 3300005530 Bacteria 1107
27 Ga0070679_100645913 3300005530 Bacteria 1001
28 Ga0070684_100141677 3300005535 Unclassified 2174
29 Ga0070684_100700045 3300005535 Viruses 944
30 Ga0070697_100843028 3300005536 Bacteria 812
31 Ga0070693_100309313 3300005547 Bacteria 1068
32 Ga0068855_100109955 3300005563 Unclassified 3164
33 Ga0068852_100187273 3300005616 Bacteria 1950
34 Ga0081455_10296823 3300005937 Unclassified 1161
35 Ga0081538_10004744 3300005981 Bacteria 12440
36 Ga0070717_10209705 3300006028 Unclassified 1709
37 Ga0070717_10413832 3300006028 Unclassified 1212
38 Ga0075365_10009272 3300006038 Bacteria 5646
39 Ga0075364_10091112 3300006051 Bacteria 2022
40 Ga0075432_10023936 3300006058 Bacteria 2092
41 Ga0070712_100549597 3300006175 Bacteria 973
42 Ga0070712_100585880 3300006175 Bacteria 943
43 Ga0075366_10581570 3300006195 Bacteria 694
44 Ga0075430_100051887 3300006846 Bacteria 3454
45 Ga0075431_100905677 3300006847 Bacteria 851
46 Ga0075434_100556383 3300006871 Unclassified 1167
47 Ga0075434_101385904 3300006871 Unclassified 713
48 Ga0075429_100383619 3300006880 Bacteria 1230
49 Ga0105240_10295055 3300009093 Bacteria 1857
50 Ga0105241_10554656 3300009174 Unclassified 1032
51 Ga0105237_11099850 3300009545 Unclassified 802
52 Ga0157370_10098739 3300013104 Bacteria 2737
53 Ga0157370_10222273 3300013104 Bacteria 1749
54 Ga0182008_10008011 3300014497 Bacteria 5790
55 Ga0182008_10022844 3300014497 Bacteria 3201
56 Ga0182006_1038666 3300015261 Bacteria 1886
57 Ga0182007_10043413 3300015262 Bacteria 1494
58 Ga0182007_10087283 3300015262 Unclassified 1026
59 Ga0206354_10419775 3300020081 Bacteria 1190
60 Ga0206353_11016187 3300020082 Bacteria 1558
61 Ga0206353_11201924 3300020082 Bacteria 2483
62 Ga0213871_10011049 3300021441 Bacteria 2064
63 Ga0207705_10026509 3300025909 Bacteria 4133
64 Ga0207705_10295504 3300025909 Bacteria 1241
65 Ga0207707_10019106 3300025912 Bacteria 5981
66 Ga0207707_10342953 3300025912 Unclassified 1288
67 Ga0207707_10504306 3300025912 Bacteria 1032
68 Ga0207663_10634799 3300025916 Bacteria 842
69 Ga0207660_10442326 3300025917 Unclassified 1051
70 Ga0207657_10001986 3300025919 Bacteria 22085
71 Ga0207657_10005437 3300025919 Bacteria 13310
72 Ga0207649_10041121 3300025920 Bacteria 2813
73 Ga0207652_10050769 3300025921 Bacteria 3554
74 Ga0207652_10075266 3300025921 Bacteria 2942
75 Ga0207652_10091010 3300025921 Bacteria 2682
76 Ga0207652_10313484 3300025921 Bacteria 1416
77 Ga0207700_10603123 3300025928 Unclassified 977
78 Ga0207664_10062136 3300025929 Bacteria 2982
79 Ga0207664_10322973 3300025929 Bacteria 1362
80 Ga0207690_10268033 3300025932 Bacteria 1325
81 Ga0207661_10070660 3300025944 Bacteria 2851
82 Ga0207639_10932043 3300026041 Unclassified 812
83 Ga0207678_10435705 3300026067 Bacteria 1138
84 Ga0207702_10651205 3300026078 Bacteria 1036
85 Ga0207428_10017483 3300027907 Bacteria 6152
86 Ga0265338_10009614 3300028800 Bacteria 11487
87 Ga0265338_10019479 3300028800 Bacteria 7194
88 Ga0265338_10041345 3300028800 Bacteria 4312
89 Ga0265327_10010235 3300031251 Bacteria 6620
90 Ga0307406_10092215 3300031901 Bacteria 2042
91 Ga0373955_0210655 3300035172 Bacteria 1159
92 Ga0395899_0332580 3300037312 Bacteria 1020
93 Ga0395900_0811424 3300037418 Unclassified 863
94 Ga0395898_0341716 3300037466 Bacteria 1427
95 Ga0395898_0447304 3300037466 Bacteria 1231
96 Ga0395898_0628104 3300037466 Bacteria 1017
97 Ga0395905_0502592 3300037471 Unclassified 1112
98 Ga0395905_0735711 3300037471 Bacteria 889
99 Ga0395901_0406867 3300038443 Bacteria 1397
100 Ga0466966_0154095 3300044684 Unclassified 1400
101 Ga0466961_0137941 3300044693 Bacteria 1528
102 Ga0466961_0260769 3300044693 Unclassified 1063
103 Ga0466963_0001831 3300044694 Bacteria 11588
104 Ga0466963_0062898 3300044694 Unclassified 2483
105 Ga0466963_0265807 3300044694 Archaea 1205
106 Ga0466963_0339287 3300044694 Bacteria 1058
107 Ga0466963_0450971 3300044694 Archaea 908
108 Ga0466963_0515840 3300044694 Bacteria 844
109 Ga0466964_0148321 3300044706 Bacteria 1085
110 Ga0466964_0184218 3300044706 Unclassified 992
111 Ga0466971_0296390 3300044719 Bacteria 776
112 Ga0466957_0053561 3300044842 Bacteria 2460
113 Ga0466957_0150414 3300044842 Unclassified 1505
114 Ga0466957_0181886 3300044842 Unclassified 1373
115 Ga0466959_0319145 3300045049 Bacteria 1062
116 Ga0466959_0403847 3300045049 Bacteria 928
117 Ga0466958_0174430 3300045836 Unclassified 1362
118 Ga0466967_0000091 3300045976 Bacteria 32078
119 Ga0466967_0002770 3300045976 Bacteria 11099
120 Ga0466967_0008561 3300045976 Bacteria 7514
121 Ga0466967_0011065 3300045976 Bacteria 6812
122 Ga0466967_0060707 3300045976 Unclassified 3352
123 Ga0466967_0066839 3300045976 Bacteria 3204
124 Ga0466967_0076975 3300045976 Bacteria 3002
125 Ga0466967_0080064 3300045976 Bacteria 2947
126 Ga0466967_0175543 3300045976 Unclassified 2018
127 Ga0466967_0320588 3300045976 Bacteria 1494
128 Ga0466967_0451992 3300045976 Unclassified 1256
129 Ga0495592_0286577 3300046454 Bacteria 1075
130 Ga0495629_0019533 3300046459 Bacteria 4840
131 Ga0495653_0039530 3300046463 Bacteria 3695
132 Ga0495618_0182742 3300046514 Bacteria 1332
133 Ga0495628_0536006 3300046516 Bacteria 842
134 Ga0495630_0740335 3300046517 Bacteria 752
135 Ga0495652_0234331 3300046529 Unclassified 1371
136 Ga0495652_0373528 3300046529 Bacteria 1016
137 Ga0495667_0058293 3300046559 Bacteria 2537
138 Ga0495667_0186048 3300046559 Bacteria 1332
139 Ga0495634_0059043 3300046642 Bacteria 2556
140 Ga0495635_0010145 3300046663 Bacteria 6589
141 Ga0495635_0020710 3300046663 Bacteria 4581
142 Ga0495657_0120594 3300046675 Bacteria 1652
143 Ga0495624_0170029 3300046690 Bacteria 1330
144 Ga0495674_0108404 3300047319 Bacteria 2356
145 Ga0495680_0011338 3300047322 Bacteria 7899
146 Ga0495680_0123670 3300047322 Unclassified 1908
147 Ga0495675_0227052 3300047444 Unclassified 1128
148 Ga0495684_0320110 3300047471 Unclassified 1109
149 Ga0495593_0064678 3300047673 Bacteria 1909
150 Ga0496104_0104597 3300048907 Bacteria 2713
151 Ga0496105_0240401 3300048908 Unclassified 1470
152 Ga0496105_0415596 3300048908 Bacteria 1066
153 Ga0496106_0004665 3300048909 Bacteria 10160
154 Ga0496107_0049132 3300048910 Unclassified 3039
155 Ga0496108_0177916 3300048911 Bacteria 1842
156 Ga0496112_0052618 3300048915 Bacteria 3997
157 Ga0496112_0287212 3300048915 Bacteria 1591
158 Ga0496112_0320540 3300048915 Unclassified 1494
159 Ga0496112_0397322 3300048915 Unclassified 1318
160 Ga0496114_0541617 3300048917 Bacteria 1029
161 Ga0496114_0548366 3300048917 Unclassified 1022
162 Ga0501031_0079413 3300049568 Bacteria 2138
163 Ga0501031_0268857 3300049568 Unclassified 1107
164 Ga0501034_0001138 3300049571 Bacteria 37013
165 Ga0501036_0030915 3300049572 Bacteria 4525
166 Ga0501067_0036986 3300049583 Bacteria 2711
167 Ga0501067_0105865 3300049583 Bacteria 1563
168 Ga0501069_0052724 3300049585 Bacteria 2266
169 Ga0501072_0000778 3300049588 Bacteria 23330
170 Ga0501072_0415838 3300049588 Bacteria 1066
171 Ga0501073_0044900 3300049589 Bacteria 3114
172 Ga0501074_0025352 3300049590 Bacteria 4307
173 Ga0501074_0040105 3300049590 Bacteria 3392
174 Ga0501077_0268254 3300049593 Unclassified 1086
175 Ga0501079_0016270 3300049741 Bacteria 5684
176 Ga0501079_0233760 3300049741 Bacteria 1436
177 Ga0501080_0008582 3300049742 Bacteria 9270
178 Ga0501083_0000582 3300049744 Bacteria 23454
179 nmdc:mga00v17_22119_c1 3300050491 Bacteria 3665
180 nmdc:mga0qj67_65453_c1 3300050509 Bacteria 2894
181 nmdc:mga08y16_40493_c1 3300050511 Bacteria 4885
182 Ga0495601_0273783 3300053077 Unclassified 1101
183 Ga0495619_0103666 3300053085 Bacteria 1938
184 Ga0501082_0627621 3300060353 Bacteria 940
185 Ga0466962_0193763 3300061719 Unclassified 992
186 Ga0466962_0273375 3300061719 Unclassified 833
187 Ga0070681_10448112
188 Ga0070683_100184775
189 Ga0070683_100352054
190 Ga0070680_100018736
191 Ga0070680_100507718
192 Ga0070682_100005451
193 Ga0070660_100081915
194 Ga0070660_100764905
195 Ga0070661_100067105
196 Ga0070659_100191267
197 Ga0070709_10375052
198 Ga0070714_100062625
199 Ga0070714_100098407
200 Ga0070714_100395791
201 Ga0070713_100065729
202 Ga0070713_100210291
203 Ga0070711_100057350
204 Ga0070681_10090231
205 Ga0070681_10556845
206 Ga0070706_100309677
207 Ga0070707_100746485
208 Ga0070698_100041598
209 Ga0070679_100043387
210 Ga0070679_100107799
211 Ga0070679_100156549
212 Ga0070679_100542177
213 Ga0070679_100645913
214 Ga0070684_100141677
215 Ga0070684_100700045
216 Ga0070697_100843028
217 Ga0070693_100309313
218 Ga0068855_100109955
219 Ga0068852_100187273
220 Ga0081455_10296823
221 Ga0081538_10004744
222 Ga0070717_10209705
223 Ga0070717_10413832
224 Ga0075365_10009272
225 Ga0075364_10091112
226 Ga0075432_10023936
227 Ga0070712_100549597
228 Ga0070712_100585880
229 Ga0075366_10581570
230 Ga0075430_100051887
231 Ga0075431_100905677
232 Ga0075434_100556383
233 Ga0075434_101385904
234 Ga0075429_100383619
235 Ga0105240_10295055
236 Ga0105241_10554656
237 Ga0105237_11099850
238 Ga0157370_10098739
239 Ga0157370_10222273
240 Ga0182008_10008011
241 Ga0182008_10022844
242 Ga0182006_1038666
243 Ga0182007_10043413
244 Ga0182007_10087283
245 Ga0206354_10419775
246 Ga0206353_11016187
247 Ga0206353_11201924
248 Ga0213871_10011049
249 Ga0207705_10026509
250 Ga0207705_10295504
251 Ga0207707_10019106
252 Ga0207707_10342953
253 Ga0207707_10504306
254 Ga0207663_10634799
255 Ga0207660_10442326
256 Ga0207657_10001986
257 Ga0207657_10005437
258 Ga0207649_10041121
259 Ga0207652_10050769
260 Ga0207652_10075266
261 Ga0207652_10091010
262 Ga0207652_10313484
263 Ga0207700_10603123
264 Ga0207664_10062136
265 Ga0207664_10322973
266 Ga0207690_10268033
267 Ga0207661_10070660
268 Ga0207639_10932043
269 Ga0207678_10435705
270 Ga0207702_10651205
271 Ga0207428_10017483
272 Ga0265338_10009614
273 Ga0265338_10019479
274 Ga0265338_10041345
275 Ga0265327_10010235
276 Ga0307406_10092215
277 Ga0373955_0210655
278 Ga0395899_0332580
279 Ga0395900_0811424
280 Ga0395898_0341716
281 Ga0395898_0447304
282 Ga0395898_0628104
283 Ga0395905_0502592
284 Ga0395905_0735711
285 Ga0395901_0406867
286 Ga0466966_0154095
287 Ga0466961_0137941
288 Ga0466961_0260769
289 Ga0466963_0001831
290 Ga0466963_0062898
291 Ga0466963_0265807
292 Ga0466963_0339287
293 Ga0466963_0450971
294 Ga0466963_0515840
295 Ga0466964_0148321
296 Ga0466964_0184218
297 Ga0466971_0296390
298 Ga0466957_0053561
299 Ga0466957_0150414
300 Ga0466957_0181886
301 Ga0466959_0319145
302 Ga0466959_0403847
303 Ga0466958_0174430
304 Ga0466967_0000091
305 Ga0466967_0002770
306 Ga0466967_0008561
307 Ga0466967_0011065
308 Ga0466967_0060707
309 Ga0466967_0066839
310 Ga0466967_0076975
311 Ga0466967_0080064
312 Ga0466967_0175543
313 Ga0466967_0320588
314 Ga0466967_0451992
315 Ga0495592_0286577
316 Ga0495629_0019533
317 Ga0495653_0039530
318 Ga0495618_0182742
319 Ga0495628_0536006
320 Ga0495630_0740335
321 Ga0495652_0234331
322 Ga0495652_0373528
323 Ga0495667_0058293
324 Ga0495667_0186048
325 Ga0495634_0059043
326 Ga0495635_0010145
327 Ga0495635_0020710
328 Ga0495657_0120594
329 Ga0495624_0170029
330 Ga0495674_0108404
331 Ga0495680_0011338
332 Ga0495680_0123670
333 Ga0495675_0227052
334 Ga0495684_0320110
335 Ga0495593_0064678
336 Ga0496104_0104597
337 Ga0496105_0240401
338 Ga0496105_0415596
339 Ga0496106_0004665
340 Ga0496107_0049132
341 Ga0496108_0177916
342 Ga0496112_0052618
343 Ga0496112_0287212
344 Ga0496112_0320540
345 Ga0496112_0397322
346 Ga0496114_0541617
347 Ga0496114_0548366
348 Ga0501031_0079413
349 Ga0501031_0268857
350 Ga0501034_0001138
351 Ga0501036_0030915
352 Ga0501067_0036986
353 Ga0501067_0105865
354 Ga0501069_0052724
355 Ga0501072_0000778
356 Ga0501072_0415838
357 Ga0501073_0044900
358 Ga0501074_0025352
359 Ga0501074_0040105
360 Ga0501077_0268254
361 Ga0501079_0016270
362 Ga0501079_0233760
363 Ga0501080_0008582
364 Ga0501083_0000582
365 nmdc:mga00v17_22119_c1
366 nmdc:mga0qj67_65453_c1
367 nmdc:mga08y16_40493_c1
368 Ga0495601_0273783
369 Ga0495619_0103666
370 Ga0501082_0627621
371 Ga0466962_0193763
372 Ga0466962_0273375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c1g-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) 0.8236 36 101
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8179 31 101
2iw0-assembly1.cif.gz_A structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum 0.7856 32 102
2vyo-assembly1.cif.gz_A chitin deacetylase family member from encephalitozoon cuniculi 0.785 28 101
4neg-assembly1.cif.gz_A the crystal structure of tryptophan synthase subunit beta from bacillus anthracis str. 'ames ancestor' 0.7761 38 99
ID Description Score Start End Superfamily
4qysA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8001 37 97 3.40.50.1100
2iw0A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7856 32 102 3.20.20.370
2vyoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.785 28 101 3.20.20.370
5c3uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7415 36 99 3.40.50.1100
af_P14671_91_282_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7379 38 101 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7W1H368-F1-model_v4 Uncharacterized protein 0.9934 1 213
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.991 1 184
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9894 1 213
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.9857 1 184
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9848 1 213

Map