F285054

General Info

Members Datasets Scaffolds Average Seq Length
185 142 185 139

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0512439|Ga0501077_0512439_121_630
Length 169
Sequence METAPALSLIGASGAASTRVLDRGRDRSRNVVAMTPEEIVDLVHLRRARDLIDRDYAEPLDVPAMARAAHMSPAHFSRKFRAAYGETPYTYLMTRRIERAKAFLRQGMSVTDTCVAVGCTSLGSFSSRFTEIVGETPSQYRARDHRDLEVVPSCVSMIATRPRRATVTV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
61 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
73 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0
Rhizoplane 16.76
Rhizosphere 68.11
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000092 3300005327 Bacteria 81151
2 Ga0070658_10659248 3300005327 Bacteria 908
3 Ga0070680_100322072 3300005336 Bacteria 1312
4 Ga0070660_100635176 3300005339 Bacteria 894
5 Ga0070668_100209570 3300005347 Bacteria 1603
6 Ga0070709_10847924 3300005434 Bacteria 720
7 Ga0070713_100173340 3300005436 Bacteria 1934
8 Ga0070663_101677373 3300005455 Bacteria 568
9 Ga0068859_101273896 3300005617 Bacteria 810
10 Ga0068863_100006766 3300005841 Bacteria 11240
11 Ga0068858_100418936 3300005842 Bacteria 1288
12 Ga0068860_100036205 3300005843 Bacteria 4731
13 Ga0068860_100244896 3300005843 Bacteria 1744
14 Ga0068862_100338638 3300005844 Bacteria 1393
15 Ga0070717_10671088 3300006028 Bacteria 941
16 Ga0075365_10000790 3300006038 Bacteria 12946
17 Ga0075368_10091695 3300006042 Bacteria 1243
18 Ga0075363_100024806 3300006048 Bacteria 3052
19 Ga0075363_100047782 3300006048 Bacteria 2274
20 Ga0075364_10008838 3300006051 Bacteria 6030
21 Ga0075364_10741737 3300006051 Bacteria 670
22 Ga0070716_100224188 3300006173 Bacteria 1265
23 Ga0075367_10015077 3300006178 Bacteria 4192
24 Ga0075367_10046636 3300006178 Bacteria 2546
25 Ga0075370_10478286 3300006353 Bacteria 751
26 Ga0097620_101274094 3300006931 Bacteria 810
27 Ga0111539_11247744 3300009094 Bacteria 863
28 Ga0105245_11194810 3300009098 Bacteria 808
29 Ga0105245_11397578 3300009098 Bacteria 750
30 Ga0105247_10581764 3300009101 Bacteria 828
31 Ga0105242_11179221 3300009176 Bacteria 784
32 Ga0105248_10929267 3300009177 Bacteria 982
33 Ga0105248_11712530 3300009177 Bacteria 713
34 Ga0105248_12092526 3300009177 Bacteria 644
35 Ga0105249_11602008 3300009553 Bacteria 724
36 Ga0105246_10832611 3300011119 Bacteria 821
37 Ga0157370_10207525 3300013104 Bacteria 1816
38 Ga0157369_10164768 3300013105 Bacteria 2338
39 Ga0157378_11490294 3300013297 Bacteria 721
40 Ga0163162_10416641 3300013306 Bacteria 1475
41 Ga0163162_12216956 3300013306 Bacteria 631
42 Ga0163162_12282376 3300013306 Bacteria 622
43 Ga0157372_11447087 3300013307 Bacteria 792
44 Ga0157375_10959920 3300013308 Bacteria 996
45 Ga0163163_10060558 3300014325 Bacteria 3749
46 Ga0157380_10092959 3300014326 Bacteria 2493
47 Ga0157380_10717272 3300014326 Bacteria 1007
48 Ga0157380_11607814 3300014326 Bacteria 705
49 Ga0157377_10519534 3300014745 Bacteria 835
50 Ga0157376_10132027 3300014969 Bacteria 2230
51 Ga0157376_12143975 3300014969 Bacteria 597
52 Ga0157376_12928402 3300014969 Bacteria 517
53 Ga0213876_10005314 3300021384 Bacteria 7088
54 Ga0224572_1009094 3300024225 Bacteria 1848
55 Ga0224572_1098947 3300024225 Unclassified 538
56 Ga0207692_10801014 3300025898 Bacteria 616
57 Ga0207710_10498173 3300025900 Bacteria 632
58 Ga0207699_10166609 3300025906 Bacteria 1471
59 Ga0207705_10002755 3300025909 Bacteria 13470
60 Ga0207705_10379443 3300025909 Bacteria 1092
61 Ga0207693_10138381 3300025915 Bacteria 1915
62 Ga0207660_10282423 3300025917 Bacteria 1318
63 Ga0207657_10500851 3300025919 Bacteria 951
64 Ga0207687_10392617 3300025927 Bacteria 1139
65 Ga0207665_10220089 3300025939 Bacteria 1391
66 Ga0207711_12016455 3300025941 Bacteria 520
67 Ga0207668_10121247 3300025972 Bacteria 1980
68 Ga0207658_11002411 3300025986 Bacteria 762
69 Ga0207639_11418375 3300026041 Bacteria 652
70 Ga0207675_100224304 3300026118 Bacteria 1811
71 Ga0207683_10755482 3300026121 Bacteria 902
72 Ga0207683_11203665 3300026121 Bacteria 702
73 Ga0209813_10051181 3300027866 Bacteria 1291
74 Ga0209813_10176771 3300027866 Bacteria 779
75 Ga0268266_12142236 3300028379 Bacteria 532
76 Ga0268265_10902646 3300028380 Bacteria 868
77 Ga0268264_10025891 3300028381 Bacteria 4790
78 Ga0268264_10154006 3300028381 Bacteria 2064
79 Ga0373950_0005284 3300034818 Bacteria 1924
80 Ga0373939_0329280 3300035114 Bacteria 616
81 Ga0373931_0154923 3300035691 Bacteria 1338
82 Ga0373931_0519391 3300035691 Bacteria 770
83 Ga0373935_0712714 3300035692 Bacteria 738
84 Ga0373935_1016808 3300035692 Bacteria 616
85 Ga0373937_1108626 3300036401 Bacteria 740
86 Ga0395900_0432358 3300037418 Bacteria 1275
87 Ga0395898_0433698 3300037466 Bacteria 1252
88 Ga0436364_0855826 3300037853 Bacteria 617
89 Ga0395901_0435503 3300038443 Bacteria 1343
90 Ga0436365_1646100 3300039437 Bacteria 7328
91 Ga0436363_0056010 3300039450 Bacteria 507
92 Ga0436362_1295326 3300039453 Bacteria 726
93 Ga0451789_0706383 3300041443 Bacteria 573
94 Ga0451789_1100461 3300041443 Bacteria 625
95 Ga0451795_0712732 3300041456 Bacteria 677
96 Ga0451853_1752377 3300041512 Bacteria 623
97 Ga0466961_0008719 3300044693 Bacteria 6464
98 Ga0466964_0009046 3300044706 Bacteria 3746
99 Ga0466968_0519229 3300044735 Bacteria 595
100 Ga0466957_0280016 3300044842 Bacteria 1116
101 Ga0466960_0420658 3300044901 Bacteria 772
102 Ga0466959_0541042 3300045049 Bacteria 786
103 Ga0466959_0772695 3300045049 Bacteria 643
104 Ga0466967_0094485 3300045976 Bacteria 2723
105 Ga0495629_0223972 3300046459 Bacteria 1297
106 Ga0495641_0264610 3300046461 Bacteria 774
107 Ga0495651_0029190 3300046462 Bacteria 4301
108 Ga0495582_0162146 3300046473 Bacteria 1272
109 Ga0495583_0219307 3300046506 Bacteria 769
110 Ga0495608_0038427 3300046511 Bacteria 3214
111 Ga0495618_0092143 3300046514 Bacteria 1938
112 Ga0495628_0424354 3300046516 Bacteria 969
113 Ga0495642_0296076 3300046528 Bacteria 709
114 Ga0495665_0132851 3300046531 Bacteria 1303
115 Ga0495640_0119554 3300046533 Bacteria 1714
116 Ga0495586_0176378 3300046535 Bacteria 1208
117 Ga0495587_0651624 3300046536 Bacteria 578
118 Ga0495645_0087182 3300046543 Bacteria 2233
119 Ga0495625_0429657 3300046660 Bacteria 820
120 Ga0495635_0127780 3300046663 Bacteria 1733
121 Ga0495635_0442615 3300046663 Bacteria 860
122 Ga0495658_0155568 3300046683 Bacteria 1407
123 Ga0495613_0003384 3300046689 Bacteria 11919
124 Ga0495671_0410329 3300046692 Bacteria 648
125 Ga0495604_0174209 3300047317 Bacteria 1510
126 Ga0495674_0400027 3300047319 Bacteria 1109
127 Ga0495674_1006967 3300047319 Bacteria 638
128 Ga0495676_0477941 3300047321 Bacteria 820
129 Ga0495680_0116577 3300047322 Bacteria 1975
130 Ga0495684_0335336 3300047471 Bacteria 1078
131 Ga0495593_0051735 3300047673 Bacteria 2173
132 Ga0495614_0131215 3300048089 Bacteria 1109
133 Ga0496100_0702570 3300048903 Bacteria 789
134 Ga0496101_0015676 3300048904 Bacteria 5113
135 Ga0496102_0062254 3300048905 Bacteria 3417
136 Ga0496102_0723579 3300048905 Bacteria 918
137 Ga0496103_0335154 3300048906 Bacteria 973
138 Ga0496104_0136649 3300048907 Bacteria 2355
139 Ga0496105_0572252 3300048908 Bacteria 880
140 Ga0496105_0819659 3300048908 Bacteria 706
141 Ga0496106_0318222 3300048909 Bacteria 1249
142 Ga0496107_0081832 3300048910 Bacteria 2355
143 Ga0496108_0386624 3300048911 Bacteria 1222
144 Ga0496108_0686737 3300048911 Bacteria 888
145 Ga0496109_0494037 3300048912 Bacteria 1155
146 Ga0496109_0754667 3300048912 Bacteria 911
147 Ga0496109_1392534 3300048912 Bacteria 637
148 Ga0496109_1632854 3300048912 Bacteria 579
149 Ga0496110_0018013 3300048913 Bacteria 5917
150 Ga0496111_0018504 3300048914 Bacteria 4827
151 Ga0496112_0110334 3300048915 Bacteria 2721
152 Ga0496113_0092344 3300048916 Bacteria 2335
153 Ga0496113_1114651 3300048916 Bacteria 618
154 Ga0496114_0011696 3300048917 Bacteria 7018
155 Ga0496114_0064511 3300048917 Bacteria 3067
156 Ga0496114_0104511 3300048917 Bacteria 2422
157 Ga0496114_0190021 3300048917 Bacteria 1796
158 Ga0496114_0378129 3300048917 Bacteria 1254
159 Ga0496115_0007620 3300048918 Bacteria 7975
160 Ga0496115_0214832 3300048918 Bacteria 1588
161 Ga0496119_0003289 3300048922 Bacteria 16896
162 Ga0496121_0000076 3300048924 Bacteria 239775
163 Ga0501038_0067599 3300049574 Bacteria 3040
164 Ga0501039_0597942 3300049575 Bacteria 865
165 Ga0501068_0141197 3300049584 Bacteria 1510
166 Ga0501077_0512439 3300049593 Bacteria 769
167 Ga0501079_0044404 3300049741 Bacteria 3430
168 Ga0501044_0130599 3300049823 Bacteria 2506
169 Ga0501044_1451045 3300049823 Bacteria 551
170 nmdc:mga00v17_2515_c1 3300050491 Bacteria 9380
171 nmdc:mga00v17_258556_c1 3300050491 Bacteria 1129
172 nmdc:mga0yw44_182041_c1 3300050492 Bacteria 1383
173 nmdc:mga0yw44_61921_c1 3300050492 Bacteria 2297
174 nmdc:mga06z11_196500_c1 3300050494 Bacteria 1170
175 nmdc:mga06z11_25030_c1 3300050494 Bacteria 2823
176 nmdc:mga04h51_16466_c1 3300050495 Bacteria 2146
177 nmdc:mga07m45_573411_c1 3300050496 Bacteria 652
178 Ga0495601_0677015 3300053077 Bacteria 659
179 Ga0500635_0007776 3300053080 Bacteria 2916
180 Ga0495595_0149201 3300053084 Bacteria 1150
181 Ga0500583_0419655 3300053092 Bacteria 639
182 Ga0590075_021239 3300059424 Bacteria 1619
183 Ga0466962_0005014 3300061719 Bacteria 6367
184 Ga0466962_0248451 3300061719 Bacteria 874
185 Ga0466962_0644184 3300061719 Bacteria 542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0597942 Ga0501039_0597942_73_564 113
2 3300044901 Ga0466960_0420658 Ga0466960_0420658_64_501 134
3 3300013104 Ga0157370_10207525 Ga0157370_102075253 135
4 3300013105 Ga0157369_10164768 Ga0157369_101647682 135
5 3300013307 Ga0157372_11447087 Ga0157372_114470871 135
6 3300026121 Ga0207683_10755482 Ga0207683_107554822 135
7 3300005327 Ga0070658_10000092 Ga0070658_1000009248 136
8 3300005327 Ga0070658_10659248 Ga0070658_106592482 136
9 3300005336 Ga0070680_100322072 Ga0070680_1003220722 136
10 3300005339 Ga0070660_100635176 Ga0070660_1006351761 136
11 3300005347 Ga0070668_100209570 Ga0070668_1002095703 136
12 3300005434 Ga0070709_10847924 Ga0070709_108479241 136
13 3300005436 Ga0070713_100173340 Ga0070713_1001733402 136
14 3300005455 Ga0070663_101677373 Ga0070663_1016773731 136
15 3300005617 Ga0068859_101273896 Ga0068859_1012738961 136
16 3300005841 Ga0068863_100006766 Ga0068863_1000067664 136
17 3300005842 Ga0068858_100418936 Ga0068858_1004189363 136
18 3300005843 Ga0068860_100036205 Ga0068860_1000362056 136
19 3300005843 Ga0068860_100244896 Ga0068860_1002448962 136
20 3300005844 Ga0068862_100338638 Ga0068862_1003386383 136
21 3300006028 Ga0070717_10671088 Ga0070717_106710882 136
22 3300006038 Ga0075365_10000790 Ga0075365_100007902 136
23 3300006042 Ga0075368_10091695 Ga0075368_100916953 136
24 3300006048 Ga0075363_100024806 Ga0075363_1000248063 136
25 3300006048 Ga0075363_100047782 Ga0075363_1000477823 136
26 3300006051 Ga0075364_10008838 Ga0075364_100088383 136
27 3300006051 Ga0075364_10741737 Ga0075364_107417371 136
28 3300006173 Ga0070716_100224188 Ga0070716_1002241882 136
29 3300006178 Ga0075367_10015077 Ga0075367_100150774 136
30 3300006178 Ga0075367_10046636 Ga0075367_100466362 136
31 3300006353 Ga0075370_10478286 Ga0075370_104782862 136
32 3300006931 Ga0097620_101274094 Ga0097620_1012740941 136
33 3300009094 Ga0111539_11247744 Ga0111539_112477442 136
34 3300009098 Ga0105245_11194810 Ga0105245_111948102 136
35 3300009098 Ga0105245_11397578 Ga0105245_113975781 136
36 3300009101 Ga0105247_10581764 Ga0105247_105817642 136
37 3300009176 Ga0105242_11179221 Ga0105242_111792212 136
38 3300009177 Ga0105248_10929267 Ga0105248_109292672 136
39 3300009177 Ga0105248_11712530 Ga0105248_117125302 136
40 3300009177 Ga0105248_12092526 Ga0105248_120925261 136
41 3300009553 Ga0105249_11602008 Ga0105249_116020082 136
42 3300011119 Ga0105246_10832611 Ga0105246_108326111 136
43 3300013297 Ga0157378_11490294 Ga0157378_114902941 136
44 3300013306 Ga0163162_10416641 Ga0163162_104166413 136
45 3300013306 Ga0163162_12216956 Ga0163162_122169562 136
46 3300013306 Ga0163162_12282376 Ga0163162_122823761 136
47 3300013308 Ga0157375_10959920 Ga0157375_109599201 136
48 3300014325 Ga0163163_10060558 Ga0163163_100605582 136
49 3300014326 Ga0157380_10092959 Ga0157380_100929593 136
50 3300014326 Ga0157380_10717272 Ga0157380_107172722 136
51 3300014326 Ga0157380_11607814 Ga0157380_116078141 136
52 3300014745 Ga0157377_10519534 Ga0157377_105195342 136
53 3300014969 Ga0157376_10132027 Ga0157376_101320274 136
54 3300014969 Ga0157376_12143975 Ga0157376_121439751 136
55 3300014969 Ga0157376_12928402 Ga0157376_129284021 136
56 3300021384 Ga0213876_10005314 Ga0213876_100053143 136
57 3300024225 Ga0224572_1009094 Ga0224572_10090944 136
58 3300024225 Ga0224572_1098947 Ga0224572_10989471 136
59 3300025898 Ga0207692_10801014 Ga0207692_108010142 136
60 3300025900 Ga0207710_10498173 Ga0207710_104981731 136
61 3300025906 Ga0207699_10166609 Ga0207699_101666093 136
62 3300025909 Ga0207705_10002755 Ga0207705_1000275513 136
63 3300025909 Ga0207705_10379443 Ga0207705_103794431 136
64 3300025915 Ga0207693_10138381 Ga0207693_101383812 136
65 3300025917 Ga0207660_10282423 Ga0207660_102824232 136
66 3300025919 Ga0207657_10500851 Ga0207657_105008511 136
67 3300025927 Ga0207687_10392617 Ga0207687_103926171 136
68 3300025939 Ga0207665_10220089 Ga0207665_102200892 136
69 3300025941 Ga0207711_12016455 Ga0207711_120164551 136
70 3300025972 Ga0207668_10121247 Ga0207668_101212472 136
71 3300025986 Ga0207658_11002411 Ga0207658_110024111 136
72 3300026041 Ga0207639_11418375 Ga0207639_114183752 136
73 3300026118 Ga0207675_100224304 Ga0207675_1002243043 136
74 3300026121 Ga0207683_11203665 Ga0207683_112036652 136
75 3300027866 Ga0209813_10051181 Ga0209813_100511812 136
76 3300027866 Ga0209813_10176771 Ga0209813_101767711 136
77 3300028379 Ga0268266_12142236 Ga0268266_121422361 136
78 3300028380 Ga0268265_10902646 Ga0268265_109026461 136
79 3300028381 Ga0268264_10025891 Ga0268264_100258914 136
80 3300028381 Ga0268264_10154006 Ga0268264_101540062 136
81 3300034818 Ga0373950_0005284 Ga0373950_0005284_1018_1428 136
82 3300035114 Ga0373939_0329280 Ga0373939_0329280_160_570 136
83 3300035691 Ga0373931_0154923 Ga0373931_0154923_681_1091 136
84 3300035691 Ga0373931_0519391 Ga0373931_0519391_56_466 136
85 3300035692 Ga0373935_0712714 Ga0373935_0712714_45_455 136
86 3300035692 Ga0373935_1016808 Ga0373935_1016808_49_474 136
87 3300036401 Ga0373937_1108626 Ga0373937_1108626_193_603 136
88 3300037418 Ga0395900_0432358 Ga0395900_0432358_170_580 136
89 3300037466 Ga0395898_0433698 Ga0395898_0433698_376_786 136
90 3300037853 Ga0436364_0855826 Ga0436364_0855826_165_575 136
91 3300038443 Ga0395901_0435503 Ga0395901_0435503_248_658 136
92 3300039437 Ga0436365_1646100 Ga0436365_1646100_4839_5249 136
93 3300039450 Ga0436363_0056010 Ga0436363_0056010_51_461 136
94 3300039453 Ga0436362_1295326 Ga0436362_1295326_236_646 136
95 3300041443 Ga0451789_0706383 Ga0451789_0706383_88_498 136
96 3300041443 Ga0451789_1100461 Ga0451789_1100461_186_596 136
97 3300041456 Ga0451795_0712732 Ga0451795_0712732_73_483 136
98 3300041512 Ga0451853_1752377 Ga0451853_1752377_192_602 136
99 3300044693 Ga0466961_0008719 Ga0466961_0008719_2661_3071 136
100 3300044706 Ga0466964_0009046 Ga0466964_0009046_200_610 136
101 3300044735 Ga0466968_0519229 Ga0466968_0519229_50_460 136
102 3300044842 Ga0466957_0280016 Ga0466957_0280016_328_762 136
103 3300045049 Ga0466959_0541042 Ga0466959_0541042_82_492 136
104 3300045049 Ga0466959_0772695 Ga0466959_0772695_13_465 136
105 3300045976 Ga0466967_0094485 Ga0466967_0094485_1246_1686 136
106 3300046459 Ga0495629_0223972 Ga0495629_0223972_400_810 136
107 3300046461 Ga0495641_0264610 Ga0495641_0264610_159_584 136
108 3300046462 Ga0495651_0029190 Ga0495651_0029190_3217_3642 136
109 3300046473 Ga0495582_0162146 Ga0495582_0162146_400_810 136
110 3300046506 Ga0495583_0219307 Ga0495583_0219307_317_727 136
111 3300046511 Ga0495608_0038427 Ga0495608_0038427_639_1064 136
112 3300046514 Ga0495618_0092143 Ga0495618_0092143_595_1020 136
113 3300046516 Ga0495628_0424354 Ga0495628_0424354_317_727 136
114 3300046528 Ga0495642_0296076 Ga0495642_0296076_236_646 136
115 3300046531 Ga0495665_0132851 Ga0495665_0132851_700_1110 136
116 3300046533 Ga0495640_0119554 Ga0495640_0119554_582_992 136
117 3300046535 Ga0495586_0176378 Ga0495586_0176378_431_841 136
118 3300046536 Ga0495587_0651624 Ga0495587_0651624_99_509 136
119 3300046543 Ga0495645_0087182 Ga0495645_0087182_1204_1629 136
120 3300046660 Ga0495625_0429657 Ga0495625_0429657_185_682 136
121 3300046663 Ga0495635_0127780 Ga0495635_0127780_538_963 136
122 3300046663 Ga0495635_0442615 Ga0495635_0442615_409_819 136
123 3300046683 Ga0495658_0155568 Ga0495658_0155568_735_1145 136
124 3300046689 Ga0495613_0003384 Ga0495613_0003384_5146_5556 136
125 3300046692 Ga0495671_0410329 Ga0495671_0410329_140_580 136
126 3300047317 Ga0495604_0174209 Ga0495604_0174209_610_1035 136
127 3300047319 Ga0495674_0400027 Ga0495674_0400027_211_636 136
128 3300047319 Ga0495674_1006967 Ga0495674_1006967_213_623 136
129 3300047321 Ga0495676_0477941 Ga0495676_0477941_16_471 136
130 3300047322 Ga0495680_0116577 Ga0495680_0116577_590_1000 136
131 3300047471 Ga0495684_0335336 Ga0495684_0335336_418_828 136
132 3300047673 Ga0495593_0051735 Ga0495593_0051735_1671_2081 136
133 3300048089 Ga0495614_0131215 Ga0495614_0131215_354_764 136
134 3300048903 Ga0496100_0702570 Ga0496100_0702570_367_777 136
135 3300048904 Ga0496101_0015676 Ga0496101_0015676_62_472 136
136 3300048905 Ga0496102_0062254 Ga0496102_0062254_1820_2230 136
137 3300048905 Ga0496102_0723579 Ga0496102_0723579_200_610 136
138 3300048906 Ga0496103_0335154 Ga0496103_0335154_380_790 136
139 3300048907 Ga0496104_0136649 Ga0496104_0136649_1686_2132 136
140 3300048908 Ga0496105_0572252 Ga0496105_0572252_459_869 136
141 3300048908 Ga0496105_0819659 Ga0496105_0819659_124_534 136
142 3300048909 Ga0496106_0318222 Ga0496106_0318222_79_489 136
143 3300048910 Ga0496107_0081832 Ga0496107_0081832_1317_1727 136
144 3300048911 Ga0496108_0386624 Ga0496108_0386624_618_1064 136
145 3300048911 Ga0496108_0686737 Ga0496108_0686737_15_425 136
146 3300048912 Ga0496109_0494037 Ga0496109_0494037_100_510 136
147 3300048912 Ga0496109_0754667 Ga0496109_0754667_167_577 136
148 3300048912 Ga0496109_1392534 Ga0496109_1392534_169_579 136
149 3300048912 Ga0496109_1632854 Ga0496109_1632854_74_484 136
150 3300048913 Ga0496110_0018013 Ga0496110_0018013_1449_1859 136
151 3300048914 Ga0496111_0018504 Ga0496111_0018504_1839_2249 136
152 3300048915 Ga0496112_0110334 Ga0496112_0110334_951_1361 136
153 3300048916 Ga0496113_0092344 Ga0496113_0092344_31_441 136
154 3300048916 Ga0496113_1114651 Ga0496113_1114651_76_486 136
155 3300048917 Ga0496114_0011696 Ga0496114_0011696_1052_1498 136
156 3300048917 Ga0496114_0064511 Ga0496114_0064511_1386_1796 136
157 3300048917 Ga0496114_0104511 Ga0496114_0104511_706_1116 136
158 3300048917 Ga0496114_0190021 Ga0496114_0190021_766_1176 136
159 3300048917 Ga0496114_0378129 Ga0496114_0378129_671_1081 136
160 3300048918 Ga0496115_0007620 Ga0496115_0007620_1454_1864 136
161 3300048918 Ga0496115_0214832 Ga0496115_0214832_1088_1498 136
162 3300048922 Ga0496119_0003289 Ga0496119_0003289_7659_8105 136
163 3300048924 Ga0496121_0000076 Ga0496121_0000076_153409_153879 136
164 3300049574 Ga0501038_0067599 Ga0501038_0067599_1252_1680 136
165 3300049584 Ga0501068_0141197 Ga0501068_0141197_356_766 136
166 3300049593 Ga0501077_0512439 Ga0501077_0512439_121_630 136
167 3300049741 Ga0501079_0044404 Ga0501079_0044404_183_593 136
168 3300049823 Ga0501044_0130599 Ga0501044_0130599_321_749 136
169 3300049823 Ga0501044_1451045 Ga0501044_1451045_17_454 136
170 3300050491 nmdc:mga00v17_2515_c1 nmdc:mga00v17_2515_c1_2503_2919 136
171 3300050491 nmdc:mga00v17_258556_c1 nmdc:mga00v17_258556_c1_548_988 136
172 3300050492 nmdc:mga0yw44_182041_c1 nmdc:mga0yw44_182041_c1_887_1297 136
173 3300050492 nmdc:mga0yw44_61921_c1 nmdc:mga0yw44_61921_c1_1047_1463 136
174 3300050494 nmdc:mga06z11_196500_c1 nmdc:mga06z11_196500_c1_87_503 136
175 3300050494 nmdc:mga06z11_25030_c1 nmdc:mga06z11_25030_c1_614_1066 136
176 3300050495 nmdc:mga04h51_16466_c1 nmdc:mga04h51_16466_c1_491_943 136
177 3300050496 nmdc:mga07m45_573411_c1 nmdc:mga07m45_573411_c1_53_469 136
178 3300053077 Ga0495601_0677015 Ga0495601_0677015_187_597 136
179 3300053080 Ga0500635_0007776 Ga0500635_0007776_877_1287 136
180 3300053084 Ga0495595_0149201 Ga0495595_0149201_27_482 136
181 3300053092 Ga0500583_0419655 Ga0500583_0419655_100_510 136
182 3300059424 Ga0590075_021239 Ga0590075_021239_652_1074 136
183 3300061719 Ga0466962_0005014 Ga0466962_0005014_4601_5011 136
184 3300061719 Ga0466962_0248451 Ga0466962_0248451_429_839 136
185 3300061719 Ga0466962_0644184 Ga0466962_0644184_74_508 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

65

143

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

104

142

0.96

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

52

93

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.9094 10 111
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8769 13 110
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8754 9 111
5chh-assembly1.cif.gz_A crystal structure of transcriptional regulator cdpr from pseudomonas aeruginosa 0.861 28 108
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8601 11 110
ID Description Score Start End Superfamily
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9358 2 59 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.929 63 108 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9272 65 108 1.10.10.60
af_P06134_78_136_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9271 4 62 1.10.10.60
af_P36547_236_347_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9067 8 111 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2A4PDU8-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9477 10 110 GO:0003700
GO:0043565
AF-A0A3B8P303-F1-model_v4 AraC family transcriptional regulator 0.9463 10 110 GO:0003700
GO:0009893
GO:0043565
AF-A0A1G0YIA7-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9459 7 110 GO:0003700
GO:0043565
AF-A0A2A2ESI8-F1-model_v4 AraC family transcriptional regulator 0.9349 7 110 GO:0003700
GO:0043565
AF-A0A7X5E515-F1-model_v4 Helix-turn-helix domain-containing protein 0.932 1 110 GO:0003700
GO:0004553
GO:0005975
GO:0043565

Feature Viewer

pLDDT pTM Quality
84.92 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map