F284890

General Info

Members Datasets Scaffolds Average Seq Length
185 127 185 140

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0481156|Ga0495628_0481156_421_861
Length 146
Sequence MKKVLTVILIXXAAAGVLYMATSTAKGWTLKRADEKVAKFNAICDNLILGIQQYKEFVGTYPTGNNISITKALLGQTEKKVMILSVRKSDINDKGEILDPWGTPVAFYFSHNEVMIRSAGPNKVWEDSAIATADDLYRTAPIDHSR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10223658 3300005328 Bacteria 1244
2 Ga0070666_10473376 3300005335 Bacteria 906
3 Ga0070680_100629643 3300005336 Unclassified 921
4 Ga0068868_100245333 3300005338 Unclassified 1506
5 Ga0070689_100078775 3300005340 Unclassified 2584
6 Ga0070689_100832607 3300005340 Bacteria 813
7 Ga0070689_101768340 3300005340 Unclassified 563
8 Ga0070675_100293856 3300005354 Bacteria 1430
9 Ga0070673_100242105 3300005364 Bacteria 1569
10 Ga0070688_100082365 3300005365 Unclassified 2086
11 Ga0070688_100385179 3300005365 Bacteria 1034
12 Ga0070667_100787684 3300005367 Bacteria 882
13 Ga0070713_100041267 3300005436 Unclassified 3759
14 Ga0070710_10546611 3300005437 Unclassified 799
15 Ga0070711_101250264 3300005439 Bacteria 643
16 Ga0068867_101806380 3300005459 Bacteria 575
17 Ga0070679_100524636 3300005530 Unclassified 1128
18 Ga0070697_100472551 3300005536 Bacteria 1094
19 Ga0068853_101803106 3300005539 Unclassified 593
20 Ga0070686_100149719 3300005544 Bacteria 1633
21 Ga0070704_101299409 3300005549 Unclassified 665
22 Ga0068857_100001362 3300005577 Bacteria 19245
23 Ga0070702_100330281 3300005615 Bacteria 1066
24 Ga0068859_100987618 3300005617 Bacteria 924
25 Ga0068864_100015488 3300005618 Bacteria 6339
26 Ga0068866_10821042 3300005718 Unclassified 648
27 Ga0068861_100901332 3300005719 Bacteria 837
28 Ga0068863_100141589 3300005841 Bacteria 2299
29 Ga0068863_100253876 3300005841 Unclassified 1699
30 Ga0068863_101686580 3300005841 Unclassified 643
31 Ga0068858_101887945 3300005842 Bacteria 590
32 Ga0068862_101148479 3300005844 Unclassified 773
33 Ga0070717_10300801 3300006028 Unclassified 1426
34 Ga0070712_100141800 3300006175 Unclassified 1835
35 Ga0097621_100023327 3300006237 Bacteria 4816
36 Ga0097621_100279535 3300006237 Bacteria 1469
37 Ga0068871_100042030 3300006358 Bacteria 3668
38 Ga0068871_100201312 3300006358 Unclassified 1719
39 Ga0068871_100483434 3300006358 Unclassified 1114
40 Ga0068871_100832163 3300006358 Unclassified 852
41 Ga0075436_100088053 3300006914 Bacteria 2157
42 Ga0097620_100987362 3300006931 Bacteria 924
43 Ga0075435_100518358 3300007076 Bacteria 1031
44 Ga0099794_10129333 3300007265 Unclassified 1274
45 Ga0099795_10126699 3300007788 Bacteria 1026
46 Ga0105240_10007575 3300009093 Bacteria 15726
47 Ga0105245_12797043 3300009098 Unclassified 541
48 Ga0105241_11427414 3300009174 Bacteria 664
49 Ga0105242_10014150 3300009176 Bacteria 6177
50 Ga0105242_11186281 3300009176 Bacteria 782
51 Ga0105242_11364570 3300009176 Bacteria 735
52 Ga0105242_11852199 3300009176 Bacteria 643
53 Ga0105248_11287354 3300009177 Bacteria 827
54 Ga0105238_10679666 3300009551 Bacteria 1041
55 Ga0105249_11953111 3300009553 Unclassified 659
56 Ga0105239_10623840 3300010375 Unclassified 1230
57 Ga0105246_11258765 3300011119 Bacteria 684
58 Ga0157371_10747279 3300013102 Unclassified 734
59 Ga0157374_10151182 3300013296 Unclassified 2257
60 Ga0157374_10342707 3300013296 Unclassified 1484
61 Ga0157374_10731055 3300013296 Bacteria 1004
62 Ga0157374_11200672 3300013296 Unclassified 780
63 Ga0157374_11317674 3300013296 Unclassified 744
64 Ga0157374_11577761 3300013296 Unclassified 680
65 Ga0157374_11642293 3300013296 Unclassified 667
66 Ga0157378_10263580 3300013297 Unclassified 1654
67 Ga0157378_10464890 3300013297 Bacteria 1258
68 Ga0157372_11364897 3300013307 Unclassified 817
69 Ga0157375_10000643 3300013308 Bacteria 31016
70 Ga0157375_10361149 3300013308 Bacteria 1618
71 Ga0163163_10000038 3300014325 Bacteria 154457
72 Ga0163163_10067308 3300014325 Bacteria 3561
73 Ga0163163_10265431 3300014325 Unclassified 1768
74 Ga0163163_11523790 3300014325 Unclassified 730
75 Ga0157376_10743526 3300014969 Unclassified 989
76 Ga0157376_10927009 3300014969 Unclassified 890
77 Ga0163161_10706384 3300017792 Unclassified 840
78 Ga0207680_10167176 3300025903 Bacteria 1479
79 Ga0207685_10187816 3300025905 Bacteria 962
80 Ga0207645_10306356 3300025907 Bacteria 1058
81 Ga0207695_10139979 3300025913 Unclassified 2369
82 Ga0207693_10448640 3300025915 Unclassified 1008
83 Ga0207700_10293069 3300025928 Unclassified 1403
84 Ga0207686_10357925 3300025934 Bacteria 1101
85 Ga0207670_10736059 3300025936 Bacteria 818
86 Ga0207651_10249978 3300025960 Bacteria 1450
87 Ga0207641_10512665 3300026088 Bacteria 1166
88 Ga0207641_10534929 3300026088 Bacteria 1141
89 Ga0207648_10538713 3300026089 Unclassified 1071
90 Ga0207674_10013649 3300026116 Bacteria 8996
91 Ga0207428_11060911 3300027907 Bacteria 567
92 Ga0268265_11143838 3300028380 Unclassified 774
93 Ga0268265_12214095 3300028380 Unclassified 557
94 Ga0265337_1004098 3300028556 Bacteria 6127
95 Ga0265334_10089587 3300028573 Unclassified 1124
96 Ga0265323_10279588 3300028653 Unclassified 517
97 Ga0265336_10108642 3300028666 Bacteria 826
98 Ga0265338_10370270 3300028800 Bacteria 1026
99 Ga0265320_10125839 3300031240 Bacteria 1166
100 Ga0316576_10192342 3300031727 Bacteria 1538
101 Ga0316577_10133581 3300031733 Bacteria 1397
102 Ga0373926_0032230 3300035083 Bacteria 1849
103 Ga0373945_0005976 3300035116 Bacteria 3911
104 Ga0373954_0027816 3300035118 Bacteria 2597
105 Ga0373956_0118442 3300035119 Unclassified 1236
106 Ga0373957_0286705 3300035120 Unclassified 697
107 Ga0373943_0033818 3300035170 Unclassified 2437
108 Ga0373946_0011951 3300035171 Bacteria 3246
109 Ga0373962_0175431 3300035242 Unclassified 714
110 Ga0373931_0125653 3300035691 Bacteria 1471
111 Ga0373931_0683856 3300035691 Unclassified 676
112 Ga0373935_0331242 3300035692 Bacteria 1082
113 Ga0373927_0017098 3300035695 Bacteria 4779
114 Ga0373933_0308496 3300035724 Bacteria 1025
115 Ga0373947_0008919 3300035725 Bacteria 5764
116 Ga0373937_0035933 3300036401 Bacteria 4513
117 Ga0373937_0090610 3300036401 Bacteria 2832
118 Ga0373937_1251707 3300036401 Unclassified 690
119 Ga0316582_0302359 3300036647 Bacteria 1099
120 Ga0316584_0104168 3300036712 Bacteria 2124
121 Ga0373925_0005557 3300037068 Bacteria 9387
122 Ga0373925_0120638 3300037068 Unclassified 2035
123 Ga0451577_0001957 3300042876 Bacteria 25957
124 Ga0451577_0105880 3300042876 Unclassified 2514
125 Ga0451577_0147132 3300042876 Bacteria 2119
126 Ga0451577_0325863 3300042876 Bacteria 1393
127 Ga0451577_0458881 3300042876 Unclassified 1157
128 Ga0451577_1473682 3300042876 Bacteria 602
129 Ga0453684_0004442 3300044712 Bacteria 29592
130 Ga0453684_0009067 3300044712 Bacteria 17552
131 Ga0453684_1805118 3300044712 Unclassified 622
132 Ga0451576_0084940 3300045051 Bacteria 3292
133 Ga0451576_0233199 3300045051 Unclassified 1922
134 Ga0451576_0245760 3300045051 Bacteria 1870
135 Ga0451576_0256719 3300045051 Unclassified 1827
136 Ga0451576_0602110 3300045051 Unclassified 1155
137 Ga0451576_0617499 3300045051 Bacteria 1139
138 Ga0451576_0804995 3300045051 Unclassified 987
139 Ga0495592_0008014 3300046454 Bacteria 7929
140 Ga0495592_0264531 3300046454 Bacteria 1131
141 Ga0495603_0567539 3300046455 Bacteria 650
142 Ga0495629_0173857 3300046459 Unclassified 1494
143 Ga0495641_0058002 3300046461 Bacteria 1753
144 Ga0495651_0546752 3300046462 Unclassified 736
145 Ga0495580_0696384 3300046472 Unclassified 665
146 Ga0495582_0004196 3300046473 Bacteria 8103
147 Ga0495582_0023019 3300046473 Bacteria 3408
148 Ga0495639_0071586 3300046475 Bacteria 1602
149 Ga0495664_0676093 3300046477 Bacteria 611
150 Ga0495618_0089622 3300046514 Bacteria 1967
151 Ga0495628_0481156 3300046516 Bacteria 898
152 Ga0495630_0000047 3300046517 Bacteria 98136
153 Ga0495630_0126447 3300046517 Bacteria 1940
154 Ga0495630_0127179 3300046517 Bacteria 1934
155 Ga0495666_0097323 3300046526 Bacteria 1387
156 Ga0495666_0107707 3300046526 Bacteria 1310
157 Ga0495652_0205413 3300046529 Bacteria 1492
158 Ga0495665_0024376 3300046531 Unclassified 3250
159 Ga0495640_0430313 3300046533 Bacteria 808
160 Ga0495586_0000003 3300046535 Bacteria 192041
161 Ga0495586_0005163 3300046535 Bacteria 6990
162 Ga0495587_0042004 3300046536 Bacteria 2728
163 Ga0495587_0545841 3300046536 Unclassified 640
164 Ga0495587_0760562 3300046536 Unclassified 530
165 Ga0495645_0226149 3300046543 Bacteria 1256
166 Ga0495645_0348868 3300046543 Unclassified 954
167 Ga0495634_0005559 3300046642 Bacteria 9673
168 Ga0495634_0050623 3300046642 Bacteria 2788
169 Ga0495634_0132308 3300046642 Bacteria 1589
170 Ga0495635_0545018 3300046663 Bacteria 761
171 Ga0495659_0553388 3300046664 Bacteria 508
172 Ga0495599_0067855 3300046678 Bacteria 2227
173 Ga0495647_0018142 3300046681 Bacteria 2501
174 Ga0495658_0074236 3300046683 Unclassified 1981
175 Ga0495613_0025967 3300046689 Bacteria 4364
176 Ga0495613_0034246 3300046689 Bacteria 3773
177 Ga0495613_0256276 3300046689 Bacteria 1220
178 Ga0495624_0071482 3300046690 Bacteria 2159
179 Ga0495600_0914386 3300046809 Unclassified 517
180 Ga0495674_0000675 3300047319 Bacteria 32150
181 Ga0495674_0021588 3300047319 Bacteria 5953
182 Ga0495676_0028868 3300047321 Bacteria 4730
183 Ga0495676_0415343 3300047321 Bacteria 891
184 Ga0495684_0137225 3300047471 Bacteria 1835
185 nmdc:mga08x19_172068_c1 3300050514 Bacteria 1475

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0567539 Ga0495603_0567539_244_615 121
2 3300046664 Ga0495659_0553388 Ga0495659_0553388_41_406 121
3 3300025903 Ga0207680_10167176 Ga0207680_101671763 124
4 3300013296 Ga0157374_11577761 Ga0157374_115777611 127
5 3300005338 Ga0068868_100245333 Ga0068868_1002453332 128
6 3300005459 Ga0068867_101806380 Ga0068867_1018063801 128
7 3300005615 Ga0070702_100330281 Ga0070702_1003302811 128
8 3300005719 Ga0068861_100901332 Ga0068861_1009013321 128
9 3300006237 Ga0097621_100023327 Ga0097621_1000233272 128
10 3300006358 Ga0068871_100042030 Ga0068871_1000420304 128
11 3300007076 Ga0075435_100518358 Ga0075435_1005183582 128
12 3300009174 Ga0105241_11427414 Ga0105241_114274141 128
13 3300026089 Ga0207648_10538713 Ga0207648_105387132 128
14 3300037068 Ga0373925_0120638 Ga0373925_0120638_838_1248 129
15 3300046473 Ga0495582_0004196 Ga0495582_0004196_3505_3915 129
16 3300046517 Ga0495630_0000047 Ga0495630_0000047_39124_39534 129
17 3300046531 Ga0495665_0024376 Ga0495665_0024376_1949_2359 129
18 3300046535 Ga0495586_0000003 Ga0495586_0000003_124187_124597 129
19 3300046642 Ga0495634_0005559 Ga0495634_0005559_4541_4951 129
20 3300046683 Ga0495658_0074236 Ga0495658_0074236_1177_1587 129
21 3300046689 Ga0495613_0025967 Ga0495613_0025967_2604_3014 129
22 3300047319 Ga0495674_0000675 Ga0495674_0000675_5839_6249 129
23 3300047321 Ga0495676_0028868 Ga0495676_0028868_3792_4202 129
24 3300028653 Ga0265323_10279588 Ga0265323_102795881 136
25 3300042876 Ga0451577_0325863 Ga0451577_0325863_848_1261 137
26 3300009098 Ga0105245_12797043 Ga0105245_127970432 139
27 3300013296 Ga0157374_11642293 Ga0157374_116422931 139
28 3300013297 Ga0157378_10464890 Ga0157378_104648902 139
29 3300014325 Ga0163163_11523790 Ga0163163_115237902 139
30 3300014969 Ga0157376_10743526 Ga0157376_107435262 139
31 3300031727 Ga0316576_10192342 Ga0316576_101923422 139
32 3300031733 Ga0316577_10133581 Ga0316577_101335812 139
33 3300036647 Ga0316582_0302359 Ga0316582_0302359_548_973 139
34 3300036712 Ga0316584_0104168 Ga0316584_0104168_576_1001 139
35 3300044712 Ga0453684_1805118 Ga0453684_1805118_157_588 139
36 3300045051 Ga0451576_0256719 Ga0451576_0256719_1104_1535 139
37 3300045051 Ga0451576_0804995 Ga0451576_0804995_124_543 139
38 3300005328 Ga0070676_10223658 Ga0070676_102236582 140
39 3300005335 Ga0070666_10473376 Ga0070666_104733762 140
40 3300005336 Ga0070680_100629643 Ga0070680_1006296431 140
41 3300005340 Ga0070689_100078775 Ga0070689_1000787753 140
42 3300005340 Ga0070689_100832607 Ga0070689_1008326072 140
43 3300005340 Ga0070689_101768340 Ga0070689_1017683401 140
44 3300005354 Ga0070675_100293856 Ga0070675_1002938562 140
45 3300005364 Ga0070673_100242105 Ga0070673_1002421052 140
46 3300005365 Ga0070688_100082365 Ga0070688_1000823652 140
47 3300005365 Ga0070688_100385179 Ga0070688_1003851792 140
48 3300005367 Ga0070667_100787684 Ga0070667_1007876842 140
49 3300005436 Ga0070713_100041267 Ga0070713_1000412674 140
50 3300005437 Ga0070710_10546611 Ga0070710_105466112 140
51 3300005439 Ga0070711_101250264 Ga0070711_1012502641 140
52 3300005530 Ga0070679_100524636 Ga0070679_1005246362 140
53 3300005536 Ga0070697_100472551 Ga0070697_1004725512 140
54 3300005539 Ga0068853_101803106 Ga0068853_1018031061 140
55 3300005544 Ga0070686_100149719 Ga0070686_1001497192 140
56 3300005549 Ga0070704_101299409 Ga0070704_1012994091 140
57 3300005577 Ga0068857_100001362 Ga0068857_1000013625 140
58 3300005617 Ga0068859_100987618 Ga0068859_1009876181 140
59 3300005618 Ga0068864_100015488 Ga0068864_1000154887 140
60 3300005718 Ga0068866_10821042 Ga0068866_108210422 140
61 3300005841 Ga0068863_100141589 Ga0068863_1001415892 140
62 3300005841 Ga0068863_100253876 Ga0068863_1002538762 140
63 3300005841 Ga0068863_101686580 Ga0068863_1016865802 140
64 3300005842 Ga0068858_101887945 Ga0068858_1018879451 140
65 3300005844 Ga0068862_101148479 Ga0068862_1011484792 140
66 3300006028 Ga0070717_10300801 Ga0070717_103008012 140
67 3300006175 Ga0070712_100141800 Ga0070712_1001418003 140
68 3300006237 Ga0097621_100279535 Ga0097621_1002795352 140
69 3300006358 Ga0068871_100201312 Ga0068871_1002013122 140
70 3300006358 Ga0068871_100483434 Ga0068871_1004834341 140
71 3300006358 Ga0068871_100832163 Ga0068871_1008321632 140
72 3300006914 Ga0075436_100088053 Ga0075436_1000880532 140
73 3300006931 Ga0097620_100987362 Ga0097620_1009873622 140
74 3300007265 Ga0099794_10129333 Ga0099794_101293332 140
75 3300007788 Ga0099795_10126699 Ga0099795_101266991 140
76 3300009093 Ga0105240_10007575 Ga0105240_100075758 140
77 3300009176 Ga0105242_10014150 Ga0105242_100141505 140
78 3300009176 Ga0105242_11186281 Ga0105242_111862812 140
79 3300009176 Ga0105242_11364570 Ga0105242_113645702 140
80 3300009176 Ga0105242_11852199 Ga0105242_118521991 140
81 3300009177 Ga0105248_11287354 Ga0105248_112873542 140
82 3300009551 Ga0105238_10679666 Ga0105238_106796662 140
83 3300009553 Ga0105249_11953111 Ga0105249_119531112 140
84 3300010375 Ga0105239_10623840 Ga0105239_106238402 140
85 3300011119 Ga0105246_11258765 Ga0105246_112587652 140
86 3300013102 Ga0157371_10747279 Ga0157371_107472791 140
87 3300013296 Ga0157374_10151182 Ga0157374_101511822 140
88 3300013296 Ga0157374_10342707 Ga0157374_103427071 140
89 3300013296 Ga0157374_10731055 Ga0157374_107310552 140
90 3300013296 Ga0157374_11200672 Ga0157374_112006721 140
91 3300013296 Ga0157374_11317674 Ga0157374_113176741 140
92 3300013297 Ga0157378_10263580 Ga0157378_102635801 140
93 3300013307 Ga0157372_11364897 Ga0157372_113648972 140
94 3300013308 Ga0157375_10000643 Ga0157375_1000064336 140
95 3300013308 Ga0157375_10361149 Ga0157375_103611492 140
96 3300014325 Ga0163163_10000038 Ga0163163_1000003824 140
97 3300014325 Ga0163163_10067308 Ga0163163_100673083 140
98 3300014325 Ga0163163_10265431 Ga0163163_102654312 140
99 3300014969 Ga0157376_10927009 Ga0157376_109270092 140
100 3300017792 Ga0163161_10706384 Ga0163161_107063841 140
101 3300025905 Ga0207685_10187816 Ga0207685_101878161 140
102 3300025907 Ga0207645_10306356 Ga0207645_103063562 140
103 3300025913 Ga0207695_10139979 Ga0207695_101399791 140
104 3300025915 Ga0207693_10448640 Ga0207693_104486402 140
105 3300025928 Ga0207700_10293069 Ga0207700_102930692 140
106 3300025934 Ga0207686_10357925 Ga0207686_103579251 140
107 3300025936 Ga0207670_10736059 Ga0207670_107360592 140
108 3300025960 Ga0207651_10249978 Ga0207651_102499782 140
109 3300026088 Ga0207641_10512665 Ga0207641_105126652 140
110 3300026088 Ga0207641_10534929 Ga0207641_105349292 140
111 3300026116 Ga0207674_10013649 Ga0207674_100136497 140
112 3300027907 Ga0207428_11060911 Ga0207428_110609111 140
113 3300028380 Ga0268265_11143838 Ga0268265_111438382 140
114 3300028380 Ga0268265_12214095 Ga0268265_122140951 140
115 3300028556 Ga0265337_1004098 Ga0265337_10040983 140
116 3300028573 Ga0265334_10089587 Ga0265334_100895872 140
117 3300028666 Ga0265336_10108642 Ga0265336_101086422 140
118 3300028800 Ga0265338_10370270 Ga0265338_103702702 140
119 3300031240 Ga0265320_10125839 Ga0265320_101258391 140
120 3300035083 Ga0373926_0032230 Ga0373926_0032230_559_990 140
121 3300035116 Ga0373945_0005976 Ga0373945_0005976_244_675 140
122 3300035118 Ga0373954_0027816 Ga0373954_0027816_1015_1443 140
123 3300035119 Ga0373956_0118442 Ga0373956_0118442_174_602 140
124 3300035120 Ga0373957_0286705 Ga0373957_0286705_38_466 140
125 3300035170 Ga0373943_0033818 Ga0373943_0033818_233_664 140
126 3300035171 Ga0373946_0011951 Ga0373946_0011951_1803_2234 140
127 3300035242 Ga0373962_0175431 Ga0373962_0175431_257_682 140
128 3300035691 Ga0373931_0125653 Ga0373931_0125653_580_1005 140
129 3300035691 Ga0373931_0683856 Ga0373931_0683856_214_639 140
130 3300035692 Ga0373935_0331242 Ga0373935_0331242_597_1025 140
131 3300035695 Ga0373927_0017098 Ga0373927_0017098_3293_3724 140
132 3300035724 Ga0373933_0308496 Ga0373933_0308496_293_721 140
133 3300035725 Ga0373947_0008919 Ga0373947_0008919_4594_5025 140
134 3300036401 Ga0373937_0035933 Ga0373937_0035933_3645_4067 140
135 3300036401 Ga0373937_0090610 Ga0373937_0090610_1731_2156 140
136 3300036401 Ga0373937_1251707 Ga0373937_1251707_171_599 140
137 3300037068 Ga0373925_0005557 Ga0373925_0005557_6765_7196 140
138 3300042876 Ga0451577_0001957 Ga0451577_0001957_9701_10123 140
139 3300042876 Ga0451577_0105880 Ga0451577_0105880_594_1022 140
140 3300042876 Ga0451577_0147132 Ga0451577_0147132_1344_1772 140
141 3300042876 Ga0451577_0458881 Ga0451577_0458881_84_512 140
142 3300042876 Ga0451577_1473682 Ga0451577_1473682_126_548 140
143 3300044712 Ga0453684_0004442 Ga0453684_0004442_1285_1707 140
144 3300044712 Ga0453684_0009067 Ga0453684_0009067_3226_3648 140
145 3300045051 Ga0451576_0084940 Ga0451576_0084940_1415_1840 140
146 3300045051 Ga0451576_0233199 Ga0451576_0233199_628_1056 140
147 3300045051 Ga0451576_0245760 Ga0451576_0245760_1305_1742 140
148 3300045051 Ga0451576_0602110 Ga0451576_0602110_508_933 140
149 3300045051 Ga0451576_0617499 Ga0451576_0617499_620_1051 140
150 3300046454 Ga0495592_0008014 Ga0495592_0008014_4422_4850 140
151 3300046454 Ga0495592_0264531 Ga0495592_0264531_655_1083 140
152 3300046459 Ga0495629_0173857 Ga0495629_0173857_901_1329 140
153 3300046461 Ga0495641_0058002 Ga0495641_0058002_675_1103 140
154 3300046462 Ga0495651_0546752 Ga0495651_0546752_119_547 140
155 3300046472 Ga0495580_0696384 Ga0495580_0696384_203_628 140
156 3300046473 Ga0495582_0023019 Ga0495582_0023019_223_651 140
157 3300046475 Ga0495639_0071586 Ga0495639_0071586_573_1001 140
158 3300046477 Ga0495664_0676093 Ga0495664_0676093_170_598 140
159 3300046514 Ga0495618_0089622 Ga0495618_0089622_32_460 140
160 3300046516 Ga0495628_0481156 Ga0495628_0481156_421_861 140
161 3300046517 Ga0495630_0126447 Ga0495630_0126447_531_962 140
162 3300046517 Ga0495630_0127179 Ga0495630_0127179_1193_1621 140
163 3300046526 Ga0495666_0097323 Ga0495666_0097323_431_862 140
164 3300046526 Ga0495666_0107707 Ga0495666_0107707_328_756 140
165 3300046529 Ga0495652_0205413 Ga0495652_0205413_979_1407 140
166 3300046533 Ga0495640_0430313 Ga0495640_0430313_344_772 140
167 3300046535 Ga0495586_0005163 Ga0495586_0005163_1270_1698 140
168 3300046536 Ga0495587_0042004 Ga0495587_0042004_115_543 140
169 3300046536 Ga0495587_0545841 Ga0495587_0545841_90_530 140
170 3300046536 Ga0495587_0760562 Ga0495587_0760562_15_437 140
171 3300046543 Ga0495645_0226149 Ga0495645_0226149_637_1077 140
172 3300046543 Ga0495645_0348868 Ga0495645_0348868_271_696 140
173 3300046642 Ga0495634_0050623 Ga0495634_0050623_1307_1735 140
174 3300046642 Ga0495634_0132308 Ga0495634_0132308_508_936 140
175 3300046663 Ga0495635_0545018 Ga0495635_0545018_220_648 140
176 3300046678 Ga0495599_0067855 Ga0495599_0067855_1599_2024 140
177 3300046681 Ga0495647_0018142 Ga0495647_0018142_753_1181 140
178 3300046689 Ga0495613_0034246 Ga0495613_0034246_682_1110 140
179 3300046689 Ga0495613_0256276 Ga0495613_0256276_243_671 140
180 3300046690 Ga0495624_0071482 Ga0495624_0071482_895_1323 140
181 3300046809 Ga0495600_0914386 Ga0495600_0914386_72_497 140
182 3300047319 Ga0495674_0021588 Ga0495674_0021588_2310_2738 140
183 3300047321 Ga0495676_0415343 Ga0495676_0415343_423_851 140
184 3300047471 Ga0495684_0137225 Ga0495684_0137225_24_452 140
185 3300050514 nmdc:mga08x19_172068_c1 nmdc:mga08x19_172068_c1_817_1248 140

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_S 39s large subunit of the porcine mitochondrial ribosome 0.7115 101 125
7oic-assembly1.cif.gz_P cryo-em structure of late human 39s mitoribosome assembly intermediates, state 4 0.6939 101 123
6j9e-assembly1.cif.gz_J cryo-em structure of xanthomonos oryzae transcription elongation complex with nusa and the bacteriophage protein p7 0.6726 101 124
4pe2-assembly1.cif.gz_A mbp pila1 cd160 0.6597 32 116
6deg-assembly1.cif.gz_B crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from bartonella birtlesii ll-wm9 0.6202 101 124
ID Description Score Start End Superfamily
af_Q4E1Q7_3_305_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.8306 101 123 3.40.850.10
af_K7N4W2_613_747_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.724 98 124 2.30.29.30
af_A0A1D6KJM8_8_116_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7231 98 123 2.30.29.30
af_F7EZF5_90_224_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.707 99 123 2.30.29.30
af_A0A0R4IS72_31_185_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6972 98 123 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V5PP01-F1-model_v4 Uncharacterized protein 0.839 24 130
AF-A0A4Q3B7D2-F1-model_v4 deleted 0.8141 39 124
AF-B4D840-F1-model_v4 Uncharacterized protein 0.7968 25 124
AF-A0A2A2Q547-F1-model_v4 Type II secretion system protein GspG C-terminal domain-containing protein 0.7921 27 124
AF-A0A2A2QHY3-F1-model_v4 Type II secretion system protein GspG C-terminal domain-containing protein 0.7919 29 120

Feature Viewer

pLDDT pTM Quality
78.73 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map