F284890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 127 | 185 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0481156|Ga0495628_0481156_421_861 |
| Length | 146 |
| Sequence | MKKVLTVILIXXAAAGVLYMATSTAKGWTLKRADEKVAKFNAICDNLILGIQQYKEFVGTYPTGNNISITKALLGQTEKKVMILSVRKSDINDKGEILDPWGTPVAFYFSHNEVMIRSAGPNKVWEDSAIATADDLYRTAPIDHSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 36 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 67 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 69 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 71 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 75 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 76 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 77 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 78 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 79 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 80 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 81 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 82 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 83 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 84 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 85 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 87 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 88 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 89 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 91 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 92 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 95 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10223658 | 3300005328 | Bacteria | 1244 |
| 2 | Ga0070666_10473376 | 3300005335 | Bacteria | 906 |
| 3 | Ga0070680_100629643 | 3300005336 | Unclassified | 921 |
| 4 | Ga0068868_100245333 | 3300005338 | Unclassified | 1506 |
| 5 | Ga0070689_100078775 | 3300005340 | Unclassified | 2584 |
| 6 | Ga0070689_100832607 | 3300005340 | Bacteria | 813 |
| 7 | Ga0070689_101768340 | 3300005340 | Unclassified | 563 |
| 8 | Ga0070675_100293856 | 3300005354 | Bacteria | 1430 |
| 9 | Ga0070673_100242105 | 3300005364 | Bacteria | 1569 |
| 10 | Ga0070688_100082365 | 3300005365 | Unclassified | 2086 |
| 11 | Ga0070688_100385179 | 3300005365 | Bacteria | 1034 |
| 12 | Ga0070667_100787684 | 3300005367 | Bacteria | 882 |
| 13 | Ga0070713_100041267 | 3300005436 | Unclassified | 3759 |
| 14 | Ga0070710_10546611 | 3300005437 | Unclassified | 799 |
| 15 | Ga0070711_101250264 | 3300005439 | Bacteria | 643 |
| 16 | Ga0068867_101806380 | 3300005459 | Bacteria | 575 |
| 17 | Ga0070679_100524636 | 3300005530 | Unclassified | 1128 |
| 18 | Ga0070697_100472551 | 3300005536 | Bacteria | 1094 |
| 19 | Ga0068853_101803106 | 3300005539 | Unclassified | 593 |
| 20 | Ga0070686_100149719 | 3300005544 | Bacteria | 1633 |
| 21 | Ga0070704_101299409 | 3300005549 | Unclassified | 665 |
| 22 | Ga0068857_100001362 | 3300005577 | Bacteria | 19245 |
| 23 | Ga0070702_100330281 | 3300005615 | Bacteria | 1066 |
| 24 | Ga0068859_100987618 | 3300005617 | Bacteria | 924 |
| 25 | Ga0068864_100015488 | 3300005618 | Bacteria | 6339 |
| 26 | Ga0068866_10821042 | 3300005718 | Unclassified | 648 |
| 27 | Ga0068861_100901332 | 3300005719 | Bacteria | 837 |
| 28 | Ga0068863_100141589 | 3300005841 | Bacteria | 2299 |
| 29 | Ga0068863_100253876 | 3300005841 | Unclassified | 1699 |
| 30 | Ga0068863_101686580 | 3300005841 | Unclassified | 643 |
| 31 | Ga0068858_101887945 | 3300005842 | Bacteria | 590 |
| 32 | Ga0068862_101148479 | 3300005844 | Unclassified | 773 |
| 33 | Ga0070717_10300801 | 3300006028 | Unclassified | 1426 |
| 34 | Ga0070712_100141800 | 3300006175 | Unclassified | 1835 |
| 35 | Ga0097621_100023327 | 3300006237 | Bacteria | 4816 |
| 36 | Ga0097621_100279535 | 3300006237 | Bacteria | 1469 |
| 37 | Ga0068871_100042030 | 3300006358 | Bacteria | 3668 |
| 38 | Ga0068871_100201312 | 3300006358 | Unclassified | 1719 |
| 39 | Ga0068871_100483434 | 3300006358 | Unclassified | 1114 |
| 40 | Ga0068871_100832163 | 3300006358 | Unclassified | 852 |
| 41 | Ga0075436_100088053 | 3300006914 | Bacteria | 2157 |
| 42 | Ga0097620_100987362 | 3300006931 | Bacteria | 924 |
| 43 | Ga0075435_100518358 | 3300007076 | Bacteria | 1031 |
| 44 | Ga0099794_10129333 | 3300007265 | Unclassified | 1274 |
| 45 | Ga0099795_10126699 | 3300007788 | Bacteria | 1026 |
| 46 | Ga0105240_10007575 | 3300009093 | Bacteria | 15726 |
| 47 | Ga0105245_12797043 | 3300009098 | Unclassified | 541 |
| 48 | Ga0105241_11427414 | 3300009174 | Bacteria | 664 |
| 49 | Ga0105242_10014150 | 3300009176 | Bacteria | 6177 |
| 50 | Ga0105242_11186281 | 3300009176 | Bacteria | 782 |
| 51 | Ga0105242_11364570 | 3300009176 | Bacteria | 735 |
| 52 | Ga0105242_11852199 | 3300009176 | Bacteria | 643 |
| 53 | Ga0105248_11287354 | 3300009177 | Bacteria | 827 |
| 54 | Ga0105238_10679666 | 3300009551 | Bacteria | 1041 |
| 55 | Ga0105249_11953111 | 3300009553 | Unclassified | 659 |
| 56 | Ga0105239_10623840 | 3300010375 | Unclassified | 1230 |
| 57 | Ga0105246_11258765 | 3300011119 | Bacteria | 684 |
| 58 | Ga0157371_10747279 | 3300013102 | Unclassified | 734 |
| 59 | Ga0157374_10151182 | 3300013296 | Unclassified | 2257 |
| 60 | Ga0157374_10342707 | 3300013296 | Unclassified | 1484 |
| 61 | Ga0157374_10731055 | 3300013296 | Bacteria | 1004 |
| 62 | Ga0157374_11200672 | 3300013296 | Unclassified | 780 |
| 63 | Ga0157374_11317674 | 3300013296 | Unclassified | 744 |
| 64 | Ga0157374_11577761 | 3300013296 | Unclassified | 680 |
| 65 | Ga0157374_11642293 | 3300013296 | Unclassified | 667 |
| 66 | Ga0157378_10263580 | 3300013297 | Unclassified | 1654 |
| 67 | Ga0157378_10464890 | 3300013297 | Bacteria | 1258 |
| 68 | Ga0157372_11364897 | 3300013307 | Unclassified | 817 |
| 69 | Ga0157375_10000643 | 3300013308 | Bacteria | 31016 |
| 70 | Ga0157375_10361149 | 3300013308 | Bacteria | 1618 |
| 71 | Ga0163163_10000038 | 3300014325 | Bacteria | 154457 |
| 72 | Ga0163163_10067308 | 3300014325 | Bacteria | 3561 |
| 73 | Ga0163163_10265431 | 3300014325 | Unclassified | 1768 |
| 74 | Ga0163163_11523790 | 3300014325 | Unclassified | 730 |
| 75 | Ga0157376_10743526 | 3300014969 | Unclassified | 989 |
| 76 | Ga0157376_10927009 | 3300014969 | Unclassified | 890 |
| 77 | Ga0163161_10706384 | 3300017792 | Unclassified | 840 |
| 78 | Ga0207680_10167176 | 3300025903 | Bacteria | 1479 |
| 79 | Ga0207685_10187816 | 3300025905 | Bacteria | 962 |
| 80 | Ga0207645_10306356 | 3300025907 | Bacteria | 1058 |
| 81 | Ga0207695_10139979 | 3300025913 | Unclassified | 2369 |
| 82 | Ga0207693_10448640 | 3300025915 | Unclassified | 1008 |
| 83 | Ga0207700_10293069 | 3300025928 | Unclassified | 1403 |
| 84 | Ga0207686_10357925 | 3300025934 | Bacteria | 1101 |
| 85 | Ga0207670_10736059 | 3300025936 | Bacteria | 818 |
| 86 | Ga0207651_10249978 | 3300025960 | Bacteria | 1450 |
| 87 | Ga0207641_10512665 | 3300026088 | Bacteria | 1166 |
| 88 | Ga0207641_10534929 | 3300026088 | Bacteria | 1141 |
| 89 | Ga0207648_10538713 | 3300026089 | Unclassified | 1071 |
| 90 | Ga0207674_10013649 | 3300026116 | Bacteria | 8996 |
| 91 | Ga0207428_11060911 | 3300027907 | Bacteria | 567 |
| 92 | Ga0268265_11143838 | 3300028380 | Unclassified | 774 |
| 93 | Ga0268265_12214095 | 3300028380 | Unclassified | 557 |
| 94 | Ga0265337_1004098 | 3300028556 | Bacteria | 6127 |
| 95 | Ga0265334_10089587 | 3300028573 | Unclassified | 1124 |
| 96 | Ga0265323_10279588 | 3300028653 | Unclassified | 517 |
| 97 | Ga0265336_10108642 | 3300028666 | Bacteria | 826 |
| 98 | Ga0265338_10370270 | 3300028800 | Bacteria | 1026 |
| 99 | Ga0265320_10125839 | 3300031240 | Bacteria | 1166 |
| 100 | Ga0316576_10192342 | 3300031727 | Bacteria | 1538 |
| 101 | Ga0316577_10133581 | 3300031733 | Bacteria | 1397 |
| 102 | Ga0373926_0032230 | 3300035083 | Bacteria | 1849 |
| 103 | Ga0373945_0005976 | 3300035116 | Bacteria | 3911 |
| 104 | Ga0373954_0027816 | 3300035118 | Bacteria | 2597 |
| 105 | Ga0373956_0118442 | 3300035119 | Unclassified | 1236 |
| 106 | Ga0373957_0286705 | 3300035120 | Unclassified | 697 |
| 107 | Ga0373943_0033818 | 3300035170 | Unclassified | 2437 |
| 108 | Ga0373946_0011951 | 3300035171 | Bacteria | 3246 |
| 109 | Ga0373962_0175431 | 3300035242 | Unclassified | 714 |
| 110 | Ga0373931_0125653 | 3300035691 | Bacteria | 1471 |
| 111 | Ga0373931_0683856 | 3300035691 | Unclassified | 676 |
| 112 | Ga0373935_0331242 | 3300035692 | Bacteria | 1082 |
| 113 | Ga0373927_0017098 | 3300035695 | Bacteria | 4779 |
| 114 | Ga0373933_0308496 | 3300035724 | Bacteria | 1025 |
| 115 | Ga0373947_0008919 | 3300035725 | Bacteria | 5764 |
| 116 | Ga0373937_0035933 | 3300036401 | Bacteria | 4513 |
| 117 | Ga0373937_0090610 | 3300036401 | Bacteria | 2832 |
| 118 | Ga0373937_1251707 | 3300036401 | Unclassified | 690 |
| 119 | Ga0316582_0302359 | 3300036647 | Bacteria | 1099 |
| 120 | Ga0316584_0104168 | 3300036712 | Bacteria | 2124 |
| 121 | Ga0373925_0005557 | 3300037068 | Bacteria | 9387 |
| 122 | Ga0373925_0120638 | 3300037068 | Unclassified | 2035 |
| 123 | Ga0451577_0001957 | 3300042876 | Bacteria | 25957 |
| 124 | Ga0451577_0105880 | 3300042876 | Unclassified | 2514 |
| 125 | Ga0451577_0147132 | 3300042876 | Bacteria | 2119 |
| 126 | Ga0451577_0325863 | 3300042876 | Bacteria | 1393 |
| 127 | Ga0451577_0458881 | 3300042876 | Unclassified | 1157 |
| 128 | Ga0451577_1473682 | 3300042876 | Bacteria | 602 |
| 129 | Ga0453684_0004442 | 3300044712 | Bacteria | 29592 |
| 130 | Ga0453684_0009067 | 3300044712 | Bacteria | 17552 |
| 131 | Ga0453684_1805118 | 3300044712 | Unclassified | 622 |
| 132 | Ga0451576_0084940 | 3300045051 | Bacteria | 3292 |
| 133 | Ga0451576_0233199 | 3300045051 | Unclassified | 1922 |
| 134 | Ga0451576_0245760 | 3300045051 | Bacteria | 1870 |
| 135 | Ga0451576_0256719 | 3300045051 | Unclassified | 1827 |
| 136 | Ga0451576_0602110 | 3300045051 | Unclassified | 1155 |
| 137 | Ga0451576_0617499 | 3300045051 | Bacteria | 1139 |
| 138 | Ga0451576_0804995 | 3300045051 | Unclassified | 987 |
| 139 | Ga0495592_0008014 | 3300046454 | Bacteria | 7929 |
| 140 | Ga0495592_0264531 | 3300046454 | Bacteria | 1131 |
| 141 | Ga0495603_0567539 | 3300046455 | Bacteria | 650 |
| 142 | Ga0495629_0173857 | 3300046459 | Unclassified | 1494 |
| 143 | Ga0495641_0058002 | 3300046461 | Bacteria | 1753 |
| 144 | Ga0495651_0546752 | 3300046462 | Unclassified | 736 |
| 145 | Ga0495580_0696384 | 3300046472 | Unclassified | 665 |
| 146 | Ga0495582_0004196 | 3300046473 | Bacteria | 8103 |
| 147 | Ga0495582_0023019 | 3300046473 | Bacteria | 3408 |
| 148 | Ga0495639_0071586 | 3300046475 | Bacteria | 1602 |
| 149 | Ga0495664_0676093 | 3300046477 | Bacteria | 611 |
| 150 | Ga0495618_0089622 | 3300046514 | Bacteria | 1967 |
| 151 | Ga0495628_0481156 | 3300046516 | Bacteria | 898 |
| 152 | Ga0495630_0000047 | 3300046517 | Bacteria | 98136 |
| 153 | Ga0495630_0126447 | 3300046517 | Bacteria | 1940 |
| 154 | Ga0495630_0127179 | 3300046517 | Bacteria | 1934 |
| 155 | Ga0495666_0097323 | 3300046526 | Bacteria | 1387 |
| 156 | Ga0495666_0107707 | 3300046526 | Bacteria | 1310 |
| 157 | Ga0495652_0205413 | 3300046529 | Bacteria | 1492 |
| 158 | Ga0495665_0024376 | 3300046531 | Unclassified | 3250 |
| 159 | Ga0495640_0430313 | 3300046533 | Bacteria | 808 |
| 160 | Ga0495586_0000003 | 3300046535 | Bacteria | 192041 |
| 161 | Ga0495586_0005163 | 3300046535 | Bacteria | 6990 |
| 162 | Ga0495587_0042004 | 3300046536 | Bacteria | 2728 |
| 163 | Ga0495587_0545841 | 3300046536 | Unclassified | 640 |
| 164 | Ga0495587_0760562 | 3300046536 | Unclassified | 530 |
| 165 | Ga0495645_0226149 | 3300046543 | Bacteria | 1256 |
| 166 | Ga0495645_0348868 | 3300046543 | Unclassified | 954 |
| 167 | Ga0495634_0005559 | 3300046642 | Bacteria | 9673 |
| 168 | Ga0495634_0050623 | 3300046642 | Bacteria | 2788 |
| 169 | Ga0495634_0132308 | 3300046642 | Bacteria | 1589 |
| 170 | Ga0495635_0545018 | 3300046663 | Bacteria | 761 |
| 171 | Ga0495659_0553388 | 3300046664 | Bacteria | 508 |
| 172 | Ga0495599_0067855 | 3300046678 | Bacteria | 2227 |
| 173 | Ga0495647_0018142 | 3300046681 | Bacteria | 2501 |
| 174 | Ga0495658_0074236 | 3300046683 | Unclassified | 1981 |
| 175 | Ga0495613_0025967 | 3300046689 | Bacteria | 4364 |
| 176 | Ga0495613_0034246 | 3300046689 | Bacteria | 3773 |
| 177 | Ga0495613_0256276 | 3300046689 | Bacteria | 1220 |
| 178 | Ga0495624_0071482 | 3300046690 | Bacteria | 2159 |
| 179 | Ga0495600_0914386 | 3300046809 | Unclassified | 517 |
| 180 | Ga0495674_0000675 | 3300047319 | Bacteria | 32150 |
| 181 | Ga0495674_0021588 | 3300047319 | Bacteria | 5953 |
| 182 | Ga0495676_0028868 | 3300047321 | Bacteria | 4730 |
| 183 | Ga0495676_0415343 | 3300047321 | Bacteria | 891 |
| 184 | Ga0495684_0137225 | 3300047471 | Bacteria | 1835 |
| 185 | nmdc:mga08x19_172068_c1 | 3300050514 | Bacteria | 1475 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0567539 | Ga0495603_0567539_244_615 | 121 |
| 2 | 3300046664 | Ga0495659_0553388 | Ga0495659_0553388_41_406 | 121 |
| 3 | 3300025903 | Ga0207680_10167176 | Ga0207680_101671763 | 124 |
| 4 | 3300013296 | Ga0157374_11577761 | Ga0157374_115777611 | 127 |
| 5 | 3300005338 | Ga0068868_100245333 | Ga0068868_1002453332 | 128 |
| 6 | 3300005459 | Ga0068867_101806380 | Ga0068867_1018063801 | 128 |
| 7 | 3300005615 | Ga0070702_100330281 | Ga0070702_1003302811 | 128 |
| 8 | 3300005719 | Ga0068861_100901332 | Ga0068861_1009013321 | 128 |
| 9 | 3300006237 | Ga0097621_100023327 | Ga0097621_1000233272 | 128 |
| 10 | 3300006358 | Ga0068871_100042030 | Ga0068871_1000420304 | 128 |
| 11 | 3300007076 | Ga0075435_100518358 | Ga0075435_1005183582 | 128 |
| 12 | 3300009174 | Ga0105241_11427414 | Ga0105241_114274141 | 128 |
| 13 | 3300026089 | Ga0207648_10538713 | Ga0207648_105387132 | 128 |
| 14 | 3300037068 | Ga0373925_0120638 | Ga0373925_0120638_838_1248 | 129 |
| 15 | 3300046473 | Ga0495582_0004196 | Ga0495582_0004196_3505_3915 | 129 |
| 16 | 3300046517 | Ga0495630_0000047 | Ga0495630_0000047_39124_39534 | 129 |
| 17 | 3300046531 | Ga0495665_0024376 | Ga0495665_0024376_1949_2359 | 129 |
| 18 | 3300046535 | Ga0495586_0000003 | Ga0495586_0000003_124187_124597 | 129 |
| 19 | 3300046642 | Ga0495634_0005559 | Ga0495634_0005559_4541_4951 | 129 |
| 20 | 3300046683 | Ga0495658_0074236 | Ga0495658_0074236_1177_1587 | 129 |
| 21 | 3300046689 | Ga0495613_0025967 | Ga0495613_0025967_2604_3014 | 129 |
| 22 | 3300047319 | Ga0495674_0000675 | Ga0495674_0000675_5839_6249 | 129 |
| 23 | 3300047321 | Ga0495676_0028868 | Ga0495676_0028868_3792_4202 | 129 |
| 24 | 3300028653 | Ga0265323_10279588 | Ga0265323_102795881 | 136 |
| 25 | 3300042876 | Ga0451577_0325863 | Ga0451577_0325863_848_1261 | 137 |
| 26 | 3300009098 | Ga0105245_12797043 | Ga0105245_127970432 | 139 |
| 27 | 3300013296 | Ga0157374_11642293 | Ga0157374_116422931 | 139 |
| 28 | 3300013297 | Ga0157378_10464890 | Ga0157378_104648902 | 139 |
| 29 | 3300014325 | Ga0163163_11523790 | Ga0163163_115237902 | 139 |
| 30 | 3300014969 | Ga0157376_10743526 | Ga0157376_107435262 | 139 |
| 31 | 3300031727 | Ga0316576_10192342 | Ga0316576_101923422 | 139 |
| 32 | 3300031733 | Ga0316577_10133581 | Ga0316577_101335812 | 139 |
| 33 | 3300036647 | Ga0316582_0302359 | Ga0316582_0302359_548_973 | 139 |
| 34 | 3300036712 | Ga0316584_0104168 | Ga0316584_0104168_576_1001 | 139 |
| 35 | 3300044712 | Ga0453684_1805118 | Ga0453684_1805118_157_588 | 139 |
| 36 | 3300045051 | Ga0451576_0256719 | Ga0451576_0256719_1104_1535 | 139 |
| 37 | 3300045051 | Ga0451576_0804995 | Ga0451576_0804995_124_543 | 139 |
| 38 | 3300005328 | Ga0070676_10223658 | Ga0070676_102236582 | 140 |
| 39 | 3300005335 | Ga0070666_10473376 | Ga0070666_104733762 | 140 |
| 40 | 3300005336 | Ga0070680_100629643 | Ga0070680_1006296431 | 140 |
| 41 | 3300005340 | Ga0070689_100078775 | Ga0070689_1000787753 | 140 |
| 42 | 3300005340 | Ga0070689_100832607 | Ga0070689_1008326072 | 140 |
| 43 | 3300005340 | Ga0070689_101768340 | Ga0070689_1017683401 | 140 |
| 44 | 3300005354 | Ga0070675_100293856 | Ga0070675_1002938562 | 140 |
| 45 | 3300005364 | Ga0070673_100242105 | Ga0070673_1002421052 | 140 |
| 46 | 3300005365 | Ga0070688_100082365 | Ga0070688_1000823652 | 140 |
| 47 | 3300005365 | Ga0070688_100385179 | Ga0070688_1003851792 | 140 |
| 48 | 3300005367 | Ga0070667_100787684 | Ga0070667_1007876842 | 140 |
| 49 | 3300005436 | Ga0070713_100041267 | Ga0070713_1000412674 | 140 |
| 50 | 3300005437 | Ga0070710_10546611 | Ga0070710_105466112 | 140 |
| 51 | 3300005439 | Ga0070711_101250264 | Ga0070711_1012502641 | 140 |
| 52 | 3300005530 | Ga0070679_100524636 | Ga0070679_1005246362 | 140 |
| 53 | 3300005536 | Ga0070697_100472551 | Ga0070697_1004725512 | 140 |
| 54 | 3300005539 | Ga0068853_101803106 | Ga0068853_1018031061 | 140 |
| 55 | 3300005544 | Ga0070686_100149719 | Ga0070686_1001497192 | 140 |
| 56 | 3300005549 | Ga0070704_101299409 | Ga0070704_1012994091 | 140 |
| 57 | 3300005577 | Ga0068857_100001362 | Ga0068857_1000013625 | 140 |
| 58 | 3300005617 | Ga0068859_100987618 | Ga0068859_1009876181 | 140 |
| 59 | 3300005618 | Ga0068864_100015488 | Ga0068864_1000154887 | 140 |
| 60 | 3300005718 | Ga0068866_10821042 | Ga0068866_108210422 | 140 |
| 61 | 3300005841 | Ga0068863_100141589 | Ga0068863_1001415892 | 140 |
| 62 | 3300005841 | Ga0068863_100253876 | Ga0068863_1002538762 | 140 |
| 63 | 3300005841 | Ga0068863_101686580 | Ga0068863_1016865802 | 140 |
| 64 | 3300005842 | Ga0068858_101887945 | Ga0068858_1018879451 | 140 |
| 65 | 3300005844 | Ga0068862_101148479 | Ga0068862_1011484792 | 140 |
| 66 | 3300006028 | Ga0070717_10300801 | Ga0070717_103008012 | 140 |
| 67 | 3300006175 | Ga0070712_100141800 | Ga0070712_1001418003 | 140 |
| 68 | 3300006237 | Ga0097621_100279535 | Ga0097621_1002795352 | 140 |
| 69 | 3300006358 | Ga0068871_100201312 | Ga0068871_1002013122 | 140 |
| 70 | 3300006358 | Ga0068871_100483434 | Ga0068871_1004834341 | 140 |
| 71 | 3300006358 | Ga0068871_100832163 | Ga0068871_1008321632 | 140 |
| 72 | 3300006914 | Ga0075436_100088053 | Ga0075436_1000880532 | 140 |
| 73 | 3300006931 | Ga0097620_100987362 | Ga0097620_1009873622 | 140 |
| 74 | 3300007265 | Ga0099794_10129333 | Ga0099794_101293332 | 140 |
| 75 | 3300007788 | Ga0099795_10126699 | Ga0099795_101266991 | 140 |
| 76 | 3300009093 | Ga0105240_10007575 | Ga0105240_100075758 | 140 |
| 77 | 3300009176 | Ga0105242_10014150 | Ga0105242_100141505 | 140 |
| 78 | 3300009176 | Ga0105242_11186281 | Ga0105242_111862812 | 140 |
| 79 | 3300009176 | Ga0105242_11364570 | Ga0105242_113645702 | 140 |
| 80 | 3300009176 | Ga0105242_11852199 | Ga0105242_118521991 | 140 |
| 81 | 3300009177 | Ga0105248_11287354 | Ga0105248_112873542 | 140 |
| 82 | 3300009551 | Ga0105238_10679666 | Ga0105238_106796662 | 140 |
| 83 | 3300009553 | Ga0105249_11953111 | Ga0105249_119531112 | 140 |
| 84 | 3300010375 | Ga0105239_10623840 | Ga0105239_106238402 | 140 |
| 85 | 3300011119 | Ga0105246_11258765 | Ga0105246_112587652 | 140 |
| 86 | 3300013102 | Ga0157371_10747279 | Ga0157371_107472791 | 140 |
| 87 | 3300013296 | Ga0157374_10151182 | Ga0157374_101511822 | 140 |
| 88 | 3300013296 | Ga0157374_10342707 | Ga0157374_103427071 | 140 |
| 89 | 3300013296 | Ga0157374_10731055 | Ga0157374_107310552 | 140 |
| 90 | 3300013296 | Ga0157374_11200672 | Ga0157374_112006721 | 140 |
| 91 | 3300013296 | Ga0157374_11317674 | Ga0157374_113176741 | 140 |
| 92 | 3300013297 | Ga0157378_10263580 | Ga0157378_102635801 | 140 |
| 93 | 3300013307 | Ga0157372_11364897 | Ga0157372_113648972 | 140 |
| 94 | 3300013308 | Ga0157375_10000643 | Ga0157375_1000064336 | 140 |
| 95 | 3300013308 | Ga0157375_10361149 | Ga0157375_103611492 | 140 |
| 96 | 3300014325 | Ga0163163_10000038 | Ga0163163_1000003824 | 140 |
| 97 | 3300014325 | Ga0163163_10067308 | Ga0163163_100673083 | 140 |
| 98 | 3300014325 | Ga0163163_10265431 | Ga0163163_102654312 | 140 |
| 99 | 3300014969 | Ga0157376_10927009 | Ga0157376_109270092 | 140 |
| 100 | 3300017792 | Ga0163161_10706384 | Ga0163161_107063841 | 140 |
| 101 | 3300025905 | Ga0207685_10187816 | Ga0207685_101878161 | 140 |
| 102 | 3300025907 | Ga0207645_10306356 | Ga0207645_103063562 | 140 |
| 103 | 3300025913 | Ga0207695_10139979 | Ga0207695_101399791 | 140 |
| 104 | 3300025915 | Ga0207693_10448640 | Ga0207693_104486402 | 140 |
| 105 | 3300025928 | Ga0207700_10293069 | Ga0207700_102930692 | 140 |
| 106 | 3300025934 | Ga0207686_10357925 | Ga0207686_103579251 | 140 |
| 107 | 3300025936 | Ga0207670_10736059 | Ga0207670_107360592 | 140 |
| 108 | 3300025960 | Ga0207651_10249978 | Ga0207651_102499782 | 140 |
| 109 | 3300026088 | Ga0207641_10512665 | Ga0207641_105126652 | 140 |
| 110 | 3300026088 | Ga0207641_10534929 | Ga0207641_105349292 | 140 |
| 111 | 3300026116 | Ga0207674_10013649 | Ga0207674_100136497 | 140 |
| 112 | 3300027907 | Ga0207428_11060911 | Ga0207428_110609111 | 140 |
| 113 | 3300028380 | Ga0268265_11143838 | Ga0268265_111438382 | 140 |
| 114 | 3300028380 | Ga0268265_12214095 | Ga0268265_122140951 | 140 |
| 115 | 3300028556 | Ga0265337_1004098 | Ga0265337_10040983 | 140 |
| 116 | 3300028573 | Ga0265334_10089587 | Ga0265334_100895872 | 140 |
| 117 | 3300028666 | Ga0265336_10108642 | Ga0265336_101086422 | 140 |
| 118 | 3300028800 | Ga0265338_10370270 | Ga0265338_103702702 | 140 |
| 119 | 3300031240 | Ga0265320_10125839 | Ga0265320_101258391 | 140 |
| 120 | 3300035083 | Ga0373926_0032230 | Ga0373926_0032230_559_990 | 140 |
| 121 | 3300035116 | Ga0373945_0005976 | Ga0373945_0005976_244_675 | 140 |
| 122 | 3300035118 | Ga0373954_0027816 | Ga0373954_0027816_1015_1443 | 140 |
| 123 | 3300035119 | Ga0373956_0118442 | Ga0373956_0118442_174_602 | 140 |
| 124 | 3300035120 | Ga0373957_0286705 | Ga0373957_0286705_38_466 | 140 |
| 125 | 3300035170 | Ga0373943_0033818 | Ga0373943_0033818_233_664 | 140 |
| 126 | 3300035171 | Ga0373946_0011951 | Ga0373946_0011951_1803_2234 | 140 |
| 127 | 3300035242 | Ga0373962_0175431 | Ga0373962_0175431_257_682 | 140 |
| 128 | 3300035691 | Ga0373931_0125653 | Ga0373931_0125653_580_1005 | 140 |
| 129 | 3300035691 | Ga0373931_0683856 | Ga0373931_0683856_214_639 | 140 |
| 130 | 3300035692 | Ga0373935_0331242 | Ga0373935_0331242_597_1025 | 140 |
| 131 | 3300035695 | Ga0373927_0017098 | Ga0373927_0017098_3293_3724 | 140 |
| 132 | 3300035724 | Ga0373933_0308496 | Ga0373933_0308496_293_721 | 140 |
| 133 | 3300035725 | Ga0373947_0008919 | Ga0373947_0008919_4594_5025 | 140 |
| 134 | 3300036401 | Ga0373937_0035933 | Ga0373937_0035933_3645_4067 | 140 |
| 135 | 3300036401 | Ga0373937_0090610 | Ga0373937_0090610_1731_2156 | 140 |
| 136 | 3300036401 | Ga0373937_1251707 | Ga0373937_1251707_171_599 | 140 |
| 137 | 3300037068 | Ga0373925_0005557 | Ga0373925_0005557_6765_7196 | 140 |
| 138 | 3300042876 | Ga0451577_0001957 | Ga0451577_0001957_9701_10123 | 140 |
| 139 | 3300042876 | Ga0451577_0105880 | Ga0451577_0105880_594_1022 | 140 |
| 140 | 3300042876 | Ga0451577_0147132 | Ga0451577_0147132_1344_1772 | 140 |
| 141 | 3300042876 | Ga0451577_0458881 | Ga0451577_0458881_84_512 | 140 |
| 142 | 3300042876 | Ga0451577_1473682 | Ga0451577_1473682_126_548 | 140 |
| 143 | 3300044712 | Ga0453684_0004442 | Ga0453684_0004442_1285_1707 | 140 |
| 144 | 3300044712 | Ga0453684_0009067 | Ga0453684_0009067_3226_3648 | 140 |
| 145 | 3300045051 | Ga0451576_0084940 | Ga0451576_0084940_1415_1840 | 140 |
| 146 | 3300045051 | Ga0451576_0233199 | Ga0451576_0233199_628_1056 | 140 |
| 147 | 3300045051 | Ga0451576_0245760 | Ga0451576_0245760_1305_1742 | 140 |
| 148 | 3300045051 | Ga0451576_0602110 | Ga0451576_0602110_508_933 | 140 |
| 149 | 3300045051 | Ga0451576_0617499 | Ga0451576_0617499_620_1051 | 140 |
| 150 | 3300046454 | Ga0495592_0008014 | Ga0495592_0008014_4422_4850 | 140 |
| 151 | 3300046454 | Ga0495592_0264531 | Ga0495592_0264531_655_1083 | 140 |
| 152 | 3300046459 | Ga0495629_0173857 | Ga0495629_0173857_901_1329 | 140 |
| 153 | 3300046461 | Ga0495641_0058002 | Ga0495641_0058002_675_1103 | 140 |
| 154 | 3300046462 | Ga0495651_0546752 | Ga0495651_0546752_119_547 | 140 |
| 155 | 3300046472 | Ga0495580_0696384 | Ga0495580_0696384_203_628 | 140 |
| 156 | 3300046473 | Ga0495582_0023019 | Ga0495582_0023019_223_651 | 140 |
| 157 | 3300046475 | Ga0495639_0071586 | Ga0495639_0071586_573_1001 | 140 |
| 158 | 3300046477 | Ga0495664_0676093 | Ga0495664_0676093_170_598 | 140 |
| 159 | 3300046514 | Ga0495618_0089622 | Ga0495618_0089622_32_460 | 140 |
| 160 | 3300046516 | Ga0495628_0481156 | Ga0495628_0481156_421_861 | 140 |
| 161 | 3300046517 | Ga0495630_0126447 | Ga0495630_0126447_531_962 | 140 |
| 162 | 3300046517 | Ga0495630_0127179 | Ga0495630_0127179_1193_1621 | 140 |
| 163 | 3300046526 | Ga0495666_0097323 | Ga0495666_0097323_431_862 | 140 |
| 164 | 3300046526 | Ga0495666_0107707 | Ga0495666_0107707_328_756 | 140 |
| 165 | 3300046529 | Ga0495652_0205413 | Ga0495652_0205413_979_1407 | 140 |
| 166 | 3300046533 | Ga0495640_0430313 | Ga0495640_0430313_344_772 | 140 |
| 167 | 3300046535 | Ga0495586_0005163 | Ga0495586_0005163_1270_1698 | 140 |
| 168 | 3300046536 | Ga0495587_0042004 | Ga0495587_0042004_115_543 | 140 |
| 169 | 3300046536 | Ga0495587_0545841 | Ga0495587_0545841_90_530 | 140 |
| 170 | 3300046536 | Ga0495587_0760562 | Ga0495587_0760562_15_437 | 140 |
| 171 | 3300046543 | Ga0495645_0226149 | Ga0495645_0226149_637_1077 | 140 |
| 172 | 3300046543 | Ga0495645_0348868 | Ga0495645_0348868_271_696 | 140 |
| 173 | 3300046642 | Ga0495634_0050623 | Ga0495634_0050623_1307_1735 | 140 |
| 174 | 3300046642 | Ga0495634_0132308 | Ga0495634_0132308_508_936 | 140 |
| 175 | 3300046663 | Ga0495635_0545018 | Ga0495635_0545018_220_648 | 140 |
| 176 | 3300046678 | Ga0495599_0067855 | Ga0495599_0067855_1599_2024 | 140 |
| 177 | 3300046681 | Ga0495647_0018142 | Ga0495647_0018142_753_1181 | 140 |
| 178 | 3300046689 | Ga0495613_0034246 | Ga0495613_0034246_682_1110 | 140 |
| 179 | 3300046689 | Ga0495613_0256276 | Ga0495613_0256276_243_671 | 140 |
| 180 | 3300046690 | Ga0495624_0071482 | Ga0495624_0071482_895_1323 | 140 |
| 181 | 3300046809 | Ga0495600_0914386 | Ga0495600_0914386_72_497 | 140 |
| 182 | 3300047319 | Ga0495674_0021588 | Ga0495674_0021588_2310_2738 | 140 |
| 183 | 3300047321 | Ga0495676_0415343 | Ga0495676_0415343_423_851 | 140 |
| 184 | 3300047471 | Ga0495684_0137225 | Ga0495684_0137225_24_452 | 140 |
| 185 | 3300050514 | nmdc:mga08x19_172068_c1 | nmdc:mga08x19_172068_c1_817_1248 | 140 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ce4-assembly1.cif.gz_S | 39s large subunit of the porcine mitochondrial ribosome | 0.7115 | 101 | 125 |
| 7oic-assembly1.cif.gz_P | cryo-em structure of late human 39s mitoribosome assembly intermediates, state 4 | 0.6939 | 101 | 123 |
| 6j9e-assembly1.cif.gz_J | cryo-em structure of xanthomonos oryzae transcription elongation complex with nusa and the bacteriophage protein p7 | 0.6726 | 101 | 124 |
| 4pe2-assembly1.cif.gz_A | mbp pila1 cd160 | 0.6597 | 32 | 116 |
| 6deg-assembly1.cif.gz_B | crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from bartonella birtlesii ll-wm9 | 0.6202 | 101 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E1Q7_3_305_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.8306 | 101 | 123 | 3.40.850.10 |
| af_K7N4W2_613_747_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.724 | 98 | 124 | 2.30.29.30 |
| af_A0A1D6KJM8_8_116_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7231 | 98 | 123 | 2.30.29.30 |
| af_F7EZF5_90_224_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.707 | 99 | 123 | 2.30.29.30 |
| af_A0A0R4IS72_31_185_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6972 | 98 | 123 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5PP01-F1-model_v4 | Uncharacterized protein | 0.839 | 24 | 130 |
|
| AF-A0A4Q3B7D2-F1-model_v4 | deleted | 0.8141 | 39 | 124 |
|
| AF-B4D840-F1-model_v4 | Uncharacterized protein | 0.7968 | 25 | 124 |
|
| AF-A0A2A2Q547-F1-model_v4 | Type II secretion system protein GspG C-terminal domain-containing protein | 0.7921 | 27 | 124 |
|
| AF-A0A2A2QHY3-F1-model_v4 | Type II secretion system protein GspG C-terminal domain-containing protein | 0.7919 | 29 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar