F284823

General Info

Members Datasets Scaffolds Average Seq Length
185 115 370 356

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0173021|Ga0451576_0173021_1002_2204
Length 400
Sequence MAAVPQDSALLAWILDANENYMHLPYNRGMEQPRPQLLIEGLRIRYGGTGPTVVDGLTLALGKGEIGCVVGSSGCGKTTLLRAIAGFIPVASGTIEIGGLVVSGPNFTAAPEKRGVGLVFQDYALFPHLRVDDNVGFGLRQLGAAERRARVDEMLGLVGLGREAARYPHELSGGQQQRVALARALAPRPALLLMDEPFSSLDVELRARLGTEVRQILKTSGTTAILVTHDQQEAFAIADRVGVMNAGRLEQWDRPYELYHRPATRYVADFIGEGVFLPAKVLNPMNVEIELGALKGDVPLPCQQGCDTCGKGCHVEVLLRPDDVVHDDASALKAEVVRKTFRGGDFIYTLRLDSGREVLALVPSHHDHAVGEKIGIRLDADHVITFPTDERRARIPLKAA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
45 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
46 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
47 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
48 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
49 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
53 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
54 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
55 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
56 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
57 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
58 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
59 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
90 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
91 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
92 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
97 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
98 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
99 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
115 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0
Rhizoplane 1.62
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0173021 3300045051 Bacteria 2254
2 Ga0070670_100204484 3300005331 Bacteria 1716
3 Ga0070668_100020615 3300005347 Bacteria 4976
4 Ga0070667_100230123 3300005367 Bacteria 1653
5 Ga0070705_100132551 3300005440 Bacteria 1628
6 Ga0070694_100021306 3300005444 Bacteria 4140
7 Ga0068867_100305115 3300005459 Bacteria 1314
8 Ga0070698_100194512 3300005471 Bacteria 1965
9 Ga0070698_100309325 3300005471 Bacteria 1511
10 Ga0070696_100102238 3300005546 Bacteria 2055
11 Ga0070665_100157267 3300005548 Bacteria 2275
12 Ga0070704_100011376 3300005549 Bacteria 5451
13 Ga0070704_100071243 3300005549 Bacteria 2525
14 Ga0070704_100129711 3300005549 Bacteria 1952
15 Ga0068863_100075742 3300005841 Bacteria 3184
16 Ga0068862_100027047 3300005844 Bacteria 4825
17 Ga0075367_10028405 3300006178 Bacteria 3191
18 Ga0075369_10002779 3300006186 Bacteria 6288
19 Ga0075366_10025570 3300006195 Bacteria 3450
20 Ga0075370_10017156 3300006353 Bacteria 3908
21 Ga0075428_100049788 3300006844 Bacteria 4597
22 Ga0075428_100535929 3300006844 Bacteria 1252
23 Ga0075430_100009073 3300006846 Bacteria 8404
24 Ga0075430_100042570 3300006846 Bacteria 3840
25 Ga0075430_100128684 3300006846 Bacteria 2111
26 Ga0075430_100367333 3300006846 Bacteria 1188
27 Ga0075429_100000183 3300006880 Bacteria 40888
28 Ga0075429_100002479 3300006880 Bacteria 15530
29 Ga0111539_10015219 3300009094 Bacteria 9585
30 Ga0111539_10073133 3300009094 Bacteria 4041
31 Ga0114129_10003951 3300009147 Bacteria 20933
32 Ga0105248_10115315 3300009177 Bacteria 3030
33 Ga0105246_10089762 3300011119 Bacteria 2212
34 Ga0157370_10013663 3300013104 Bacteria 8349
35 Ga0157375_10069569 3300013308 Bacteria 3527
36 Ga0157376_10122312 3300014969 Bacteria 2309
37 Ga0207645_10132681 3300025907 Bacteria 1621
38 Ga0207657_10044597 3300025919 Bacteria 3897
39 Ga0207664_10019018 3300025929 Bacteria 5070
40 Ga0207706_10199849 3300025933 Bacteria 1753
41 Ga0207668_10275883 3300025972 Bacteria 1376
42 Ga0207658_10309830 3300025986 Bacteria 1363
43 Ga0207641_10246459 3300026088 Bacteria 1667
44 Ga0207648_10075390 3300026089 Bacteria 2940
45 Ga0207675_100554589 3300026118 Bacteria 1149
46 Ga0209813_10012247 3300027866 Bacteria 2262
47 Ga0207428_10078771 3300027907 Bacteria 2578
48 Ga0268266_10064390 3300028379 Bacteria 3167
49 Ga0268264_10198630 3300028381 Bacteria 1833
50 Ga0316575_10003802 3300031665 Bacteria 5256
51 Ga0307412_10093515 3300031911 Bacteria 2109
52 Ga0307409_100453048 3300031995 Bacteria 1239
53 Ga0316574_0010144 3300035398 Bacteria 5309
54 Ga0400484_12896 3300038725 Bacteria 5677
55 Ga0400484_22533 3300038725 Bacteria 5211
56 Ga0400490_00276 3300038726 Bacteria 11616
57 Ga0400490_32268 3300038726 Bacteria 35545
58 Ga0400490_39522 3300038726 Bacteria 5276
59 Ga0400491_02007 3300038727 Bacteria 3023
60 Ga0400491_11127 3300038727 Bacteria 2454
61 Ga0400485_00534 3300038735 Bacteria 8430
62 Ga0400485_14932 3300038735 Bacteria 3501
63 Ga0400488_18678 3300038741 Bacteria 13490
64 Ga0400488_46430 3300038741 Bacteria 8776
65 Ga0400488_61052 3300038741 Bacteria 2041
66 Ga0400486_08718 3300038742 Bacteria 10442
67 Ga0400483_032575 3300039062 Bacteria 5421
68 Ga0400483_092264 3300039062 Bacteria 14863
69 Ga0400483_123435 3300039062 Bacteria 6598
70 Ga0400483_124989 3300039062 Bacteria 10839
71 Ga0400483_177885 3300039062 Bacteria 21345
72 Ga0400483_217190 3300039062 Bacteria 20156
73 Ga0400483_256193 3300039062 Bacteria 16713
74 Ga0400483_270775 3300039062 Bacteria 14026
75 Ga0400487_03821 3300039110 Bacteria 9143
76 Ga0400487_05324 3300039110 Bacteria 4700
77 Ga0400487_07102 3300039110 Bacteria 2975
78 Ga0400487_20455 3300039110 Bacteria 2648
79 Ga0400487_21536 3300039110 Bacteria 7319
80 Ga0400487_25945 3300039110 Bacteria 95730
81 Ga0400487_46439 3300039110 Bacteria 1785
82 Ga0439443_003061 3300042003 Bacteria 2070
83 Ga0450917_001221 3300042120 Bacteria 1862
84 Ga0450888_000546 3300042126 Bacteria 3552
85 Ga0450892_000292 3300042130 Bacteria 5924
86 Ga0450889_000486 3300042144 Bacteria 4418
87 Ga0439435_0018378 3300042436 Bacteria 1778
88 Ga0439460_0033683 3300042461 Bacteria 1472
89 Ga0451577_0009076 3300042876 Bacteria 9596
90 Ga0451577_0010177 3300042876 Bacteria 9011
91 Ga0451577_0014355 3300042876 Bacteria 7385
92 Ga0451577_0376918 3300042876 Bacteria 1287
93 Ga0453683_0011308 3300044673 Bacteria 5887
94 Ga0453683_0087849 3300044673 Bacteria 1949
95 Ga0453684_0430600 3300044712 Bacteria 1472
96 Ga0451576_0000227 3300045051 Bacteria 137818
97 Ga0451576_0012456 3300045051 Bacteria 9551
98 Ga0451576_0072056 3300045051 Bacteria 3596
99 Ga0451576_0119217 3300045051 Bacteria 2747
100 Ga0496100_0011552 3300048903 Bacteria 5030
101 Ga0496104_0358366 3300048907 Bacteria 1371
102 Ga0496114_0015134 3300048917 Bacteria 6203
103 Ga0501031_0009455 3300049568 Bacteria 6338
104 Ga0501032_0014665 3300049569 Bacteria 5549
105 Ga0501033_0010324 3300049570 Bacteria 7168
106 Ga0501034_0074923 3300049571 Bacteria 3392
107 Ga0501036_0000592 3300049572 Bacteria 26278
108 Ga0501036_0007804 3300049572 Bacteria 8752
109 Ga0501037_0174603 3300049573 Bacteria 1526
110 Ga0501038_0000396 3300049574 Bacteria 37861
111 Ga0501038_0005592 3300049574 Bacteria 11663
112 Ga0501038_0068484 3300049574 Bacteria 3017
113 Ga0501038_0184463 3300049574 Bacteria 1682
114 Ga0501039_0001401 3300049575 Bacteria 17721
115 Ga0501039_0044957 3300049575 Bacteria 3411
116 Ga0501039_0246021 3300049575 Bacteria 1406
117 Ga0501040_0001314 3300049576 Bacteria 15755
118 Ga0501040_0024093 3300049576 Bacteria 4084
119 Ga0501040_0063020 3300049576 Bacteria 2550
120 Ga0501041_0000044 3300049577 Bacteria 43476
121 Ga0501042_0000702 3300049578 Bacteria 18174
122 Ga0501042_0006314 3300049578 Bacteria 7688
123 Ga0501043_0002105 3300049579 Bacteria 16990
124 Ga0501046_0204063 3300049580 Bacteria 1470
125 Ga0501047_0088865 3300049581 Bacteria 2967
126 Ga0501048_0001330 3300049582 Bacteria 18732
127 Ga0501048_0271492 3300049582 Bacteria 1205
128 Ga0501068_0008883 3300049584 Bacteria 5608
129 Ga0501071_0004000 3300049587 Bacteria 9302
130 Ga0501071_0086870 3300049587 Bacteria 2294
131 Ga0501072_0005147 3300049588 Bacteria 9944
132 Ga0501072_0037452 3300049588 Bacteria 3804
133 Ga0501072_0215879 3300049588 Bacteria 1529
134 Ga0501073_0054572 3300049589 Bacteria 2797
135 Ga0501073_0158499 3300049589 Bacteria 1568
136 Ga0501073_0290011 3300049589 Bacteria 1129
137 Ga0501074_0001854 3300049590 Bacteria 14505
138 Ga0501075_0000451 3300049591 Bacteria 24474
139 Ga0501075_0038411 3300049591 Bacteria 3579
140 Ga0501076_0000304 3300049592 Bacteria 30680
141 Ga0501076_0000508 3300049592 Bacteria 24672
142 Ga0501076_0089309 3300049592 Bacteria 2477
143 Ga0501077_0000598 3300049593 Bacteria 21812
144 Ga0501077_0008864 3300049593 Bacteria 6243
145 Ga0501222_000367 3300049662 Bacteria 6977
146 Ga0501258_001935 3300049687 Bacteria 1766
147 Ga0501221_000356 3300049704 Bacteria 6968
148 Ga0501225_0023944 3300049705 Bacteria 1682
149 Ga0501079_0000184 3300049741 Bacteria 35607
150 Ga0501080_0001609 3300049742 Bacteria 19194
151 Ga0501080_0046287 3300049742 Bacteria 4050
152 Ga0501081_0000384 3300049743 Bacteria 24346
153 Ga0501081_0013712 3300049743 Bacteria 5329
154 Ga0501081_0028727 3300049743 Bacteria 3754
155 Ga0501081_0058548 3300049743 Bacteria 2666
156 Ga0501267_000382 3300049764 Bacteria 3368
157 Ga0501272_000568 3300049769 Bacteria 3283
158 Ga0501280_000662 3300049776 Bacteria 7655
159 Ga0501282_001533 3300049778 Bacteria 2552
160 Ga0501035_0334304 3300049822 Bacteria 1270
161 Ga0501044_0015813 3300049823 Bacteria 8122
162 Ga0501044_0109316 3300049823 Bacteria 2774
163 Ga0501045_0000572 3300049824 Bacteria 23126
164 Ga0501045_0003853 3300049824 Bacteria 10322
165 Ga0501045_0022007 3300049824 Bacteria 4562
166 nmdc:mga04h51_34241_c1 3300050495 Bacteria 1622
167 nmdc:mga07m45_15833_c1 3300050496 Bacteria 4030
168 nmdc:mga05p37_12214_c1 3300050507 Bacteria 10256
169 nmdc:mga09592_1357_c1 3300050508 Bacteria 19563
170 nmdc:mga09592_2859_c1 3300050508 Bacteria 14008
171 nmdc:mga09592_402418_c1 3300050508 Bacteria 1183
172 nmdc:mga0qj67_165911_c1 3300050509 Bacteria 1793
173 nmdc:mga08y16_133600_c1 3300050511 Bacteria 2579
174 nmdc:mga08y16_64155_c1 3300050511 Bacteria 3836
175 nmdc:mga0rr50_291218_c1 3300050513 Bacteria 1364
176 nmdc:mga0a205_198151_c1 3300050515 Bacteria 1464
177 nmdc:mga0sz30_3861_c1 3300050516 Bacteria 5399
178 Ga0501084_0000800 3300054114 Bacteria 24076
179 Ga0501084_0005144 3300054114 Bacteria 10706
180 Ga0501084_0084169 3300054114 Bacteria 2670
181 Ga0501082_0004198 3300060353 Bacteria 12590
182 Ga0501082_0014914 3300060353 Bacteria 6695
183 Ga0530510_0000101 3300061734 Bacteria 46956
184 Ga0530510_0000383 3300061734 Bacteria 28772
185 2574432394 2574179768 Bacteria 4907129
186 Ga0451576_0173021
187 Ga0070670_100204484
188 Ga0070668_100020615
189 Ga0070667_100230123
190 Ga0070705_100132551
191 Ga0070694_100021306
192 Ga0068867_100305115
193 Ga0070698_100194512
194 Ga0070698_100309325
195 Ga0070696_100102238
196 Ga0070665_100157267
197 Ga0070704_100011376
198 Ga0070704_100071243
199 Ga0070704_100129711
200 Ga0068863_100075742
201 Ga0068862_100027047
202 Ga0075367_10028405
203 Ga0075369_10002779
204 Ga0075366_10025570
205 Ga0075370_10017156
206 Ga0075428_100049788
207 Ga0075428_100535929
208 Ga0075430_100009073
209 Ga0075430_100042570
210 Ga0075430_100128684
211 Ga0075430_100367333
212 Ga0075429_100000183
213 Ga0075429_100002479
214 Ga0111539_10015219
215 Ga0111539_10073133
216 Ga0114129_10003951
217 Ga0105248_10115315
218 Ga0105246_10089762
219 Ga0157370_10013663
220 Ga0157375_10069569
221 Ga0157376_10122312
222 Ga0207645_10132681
223 Ga0207657_10044597
224 Ga0207664_10019018
225 Ga0207706_10199849
226 Ga0207668_10275883
227 Ga0207658_10309830
228 Ga0207641_10246459
229 Ga0207648_10075390
230 Ga0207675_100554589
231 Ga0209813_10012247
232 Ga0207428_10078771
233 Ga0268266_10064390
234 Ga0268264_10198630
235 Ga0316575_10003802
236 Ga0307412_10093515
237 Ga0307409_100453048
238 Ga0316574_0010144
239 Ga0400484_12896
240 Ga0400484_22533
241 Ga0400490_00276
242 Ga0400490_32268
243 Ga0400490_39522
244 Ga0400491_02007
245 Ga0400491_11127
246 Ga0400485_00534
247 Ga0400485_14932
248 Ga0400488_18678
249 Ga0400488_46430
250 Ga0400488_61052
251 Ga0400486_08718
252 Ga0400483_032575
253 Ga0400483_092264
254 Ga0400483_123435
255 Ga0400483_124989
256 Ga0400483_177885
257 Ga0400483_217190
258 Ga0400483_256193
259 Ga0400483_270775
260 Ga0400487_03821
261 Ga0400487_05324
262 Ga0400487_07102
263 Ga0400487_20455
264 Ga0400487_21536
265 Ga0400487_25945
266 Ga0400487_46439
267 Ga0439443_003061
268 Ga0450917_001221
269 Ga0450888_000546
270 Ga0450892_000292
271 Ga0450889_000486
272 Ga0439435_0018378
273 Ga0439460_0033683
274 Ga0451577_0009076
275 Ga0451577_0010177
276 Ga0451577_0014355
277 Ga0451577_0376918
278 Ga0453683_0011308
279 Ga0453683_0087849
280 Ga0453684_0430600
281 Ga0451576_0000227
282 Ga0451576_0012456
283 Ga0451576_0072056
284 Ga0451576_0119217
285 Ga0496100_0011552
286 Ga0496104_0358366
287 Ga0496114_0015134
288 Ga0501031_0009455
289 Ga0501032_0014665
290 Ga0501033_0010324
291 Ga0501034_0074923
292 Ga0501036_0000592
293 Ga0501036_0007804
294 Ga0501037_0174603
295 Ga0501038_0000396
296 Ga0501038_0005592
297 Ga0501038_0068484
298 Ga0501038_0184463
299 Ga0501039_0001401
300 Ga0501039_0044957
301 Ga0501039_0246021
302 Ga0501040_0001314
303 Ga0501040_0024093
304 Ga0501040_0063020
305 Ga0501041_0000044
306 Ga0501042_0000702
307 Ga0501042_0006314
308 Ga0501043_0002105
309 Ga0501046_0204063
310 Ga0501047_0088865
311 Ga0501048_0001330
312 Ga0501048_0271492
313 Ga0501068_0008883
314 Ga0501071_0004000
315 Ga0501071_0086870
316 Ga0501072_0005147
317 Ga0501072_0037452
318 Ga0501072_0215879
319 Ga0501073_0054572
320 Ga0501073_0158499
321 Ga0501073_0290011
322 Ga0501074_0001854
323 Ga0501075_0000451
324 Ga0501075_0038411
325 Ga0501076_0000304
326 Ga0501076_0000508
327 Ga0501076_0089309
328 Ga0501077_0000598
329 Ga0501077_0008864
330 Ga0501222_000367
331 Ga0501258_001935
332 Ga0501221_000356
333 Ga0501225_0023944
334 Ga0501079_0000184
335 Ga0501080_0001609
336 Ga0501080_0046287
337 Ga0501081_0000384
338 Ga0501081_0013712
339 Ga0501081_0028727
340 Ga0501081_0058548
341 Ga0501267_000382
342 Ga0501272_000568
343 Ga0501280_000662
344 Ga0501282_001533
345 Ga0501035_0334304
346 Ga0501044_0015813
347 Ga0501044_0109316
348 Ga0501045_0000572
349 Ga0501045_0003853
350 Ga0501045_0022007
351 nmdc:mga04h51_34241_c1
352 nmdc:mga07m45_15833_c1
353 nmdc:mga05p37_12214_c1
354 nmdc:mga09592_1357_c1
355 nmdc:mga09592_2859_c1
356 nmdc:mga09592_402418_c1
357 nmdc:mga0qj67_165911_c1
358 nmdc:mga08y16_133600_c1
359 nmdc:mga08y16_64155_c1
360 nmdc:mga0rr50_291218_c1
361 nmdc:mga0a205_198151_c1
362 nmdc:mga0sz30_3861_c1
363 Ga0501084_0000800
364 Ga0501084_0005144
365 Ga0501084_0084169
366 Ga0501082_0004198
367 Ga0501082_0014914
368 Ga0530510_0000101
369 Ga0530510_0000383
370 2574432394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08402

TOBE_2

TOBE domain

317

386

0.96

PF00005

ABC_tran

ABC transporter

54

199

0.93

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

144

234

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9344 1 235
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9137 2 218
3gfo-assembly1.cif.gz_A structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq. 0.9111 2 222
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9079 2 235
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9073 3 235
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 2 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9605 1 216 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9482 3 237 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9474 2 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9474 1 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C3NV77-F1-model_v4 ABC transporter ATP-binding protein 0.9823 1 219 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9703 1 242 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A7C3NV77-F1-model_v4 ABC transporter ATP-binding protein 0.9649 1 219 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A2N5A791-F1-model_v4 Fe3+/spermidine/putrescine ABC transporter ATP-binding protein 0.9646 1 213 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A357RUW9-F1-model_v4 deleted 0.961 3 211

Map