F284808

General Info

Members Datasets Scaffolds Average Seq Length
185 129 173 185

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000056|Ga0453684_0000056_82320_82907
Length 195
Sequence MSRLIYSAISSLDGYIEDVNGQFDWAAPDEEVHGFINNLEREVGTYLLGRRMYEIMQVWETDPSLAADSAITRDFAEIWQAANKIVFSRTMAAVSTRRTRLEQNFDPAVIRQLKATAGKDISIGGPELASHAFRAGLIDECHLFLTPIIVGGAKSSLPANIRLQLELLEERRFGNGTVYLRYQATQDRTSNKAES

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
3 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
4 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
5 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
6 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
7 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
8 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
9 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
10 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
11 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
12 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
87 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
93 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.43
Metatranscriptomes 1.08
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 4.32
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10041039 3300003316 Bacteria 1803
2 rootH2_10054335 3300003320 Bacteria 2594
3 rootL2_10216735 3300003322 Bacteria 3629
4 JGI25407J50210_10062748 3300003373 Bacteria 932
5 Ga0065714_10037259 3300005288 Bacteria 804
6 Ga0070713_101086748 3300005436 Bacteria 773
7 Ga0070701_10234711 3300005438 Unclassified 1100
8 Ga0070701_10299747 3300005438 Bacteria 988
9 Ga0070705_100260472 3300005440 Bacteria 1223
10 Ga0070700_100746561 3300005441 Bacteria 783
11 Ga0070706_100068437 3300005467 Bacteria 3283
12 Ga0070706_100249115 3300005467 Bacteria 1658
13 Ga0070707_100964198 3300005468 Bacteria 818
14 Ga0070698_100004506 3300005471 Bacteria 15317
15 Ga0070698_100140401 3300005471 Bacteria 2367
16 Ga0070699_100018080 3300005518 Bacteria 6056
17 Ga0070697_100588964 3300005536 Bacteria 977
18 Ga0070695_100092442 3300005545 Bacteria 2022
19 Ga0070665_100436071 3300005548 Unclassified 1319
20 Ga0070704_100033319 3300005549 Bacteria 3481
21 Ga0068859_101224950 3300005617 Bacteria 827
22 Ga0081538_10000026 3300005981 Bacteria 126575
23 Ga0070717_10020777 3300006028 Bacteria 5168
24 Ga0075365_10064232 3300006038 Bacteria 2459
25 Ga0075364_10119056 3300006051 Bacteria 1767
26 Ga0075428_100023683 3300006844 Bacteria 6796
27 Ga0075433_10554878 3300006852 Bacteria 1010
28 Ga0075434_100371907 3300006871 Bacteria 1450
29 Ga0075429_100158802 3300006880 Unclassified 1980
30 Ga0097620_101224840 3300006931 Bacteria 827
31 Ga0111539_10813106 3300009094 Bacteria 1088
32 Ga0114129_11688268 3300009147 Bacteria 773
33 Ga0105243_10120365 3300009148 Bacteria 2212
34 Ga0105242_10394322 3300009176 Bacteria 1290
35 Ga0105249_10184077 3300009553 Bacteria 2034
36 Ga0105246_10107567 3300011119 Bacteria 2043
37 Ga0157369_10014543 3300013105 Bacteria 8879
38 Ga0157369_10181079 3300013105 Bacteria 2217
39 Ga0157378_10618332 3300013297 Bacteria 1096
40 Ga0163163_10621771 3300014325 Bacteria 1143
41 Ga0157376_10414726 3300014969 Bacteria 1305
42 Ga0207647_10086910 3300025904 Bacteria 1868
43 Ga0207684_10009636 3300025910 Bacteria 8519
44 Ga0207646_10000034 3300025922 Bacteria 212493
45 Ga0207646_10009726 3300025922 Bacteria 9476
46 Ga0207646_10793251 3300025922 Bacteria 844
47 Ga0207686_10652375 3300025934 Bacteria 833
48 Ga0207712_10824036 3300025961 Bacteria 817
49 Ga0207708_10008577 3300026075 Bacteria 7564
50 Ga0207641_10401669 3300026088 Bacteria 1316
51 Ga0207675_100300991 3300026118 Bacteria 1562
52 Ga0268266_10305303 3300028379 Unclassified 1486
53 Ga0268265_10405147 3300028380 Bacteria 1262
54 Ga0307408_100028343 3300031548 Bacteria 3869
55 Ga0307408_100048116 3300031548 Bacteria 3057
56 Ga0307408_100117634 3300031548 Bacteria 2053
57 Ga0307408_100313688 3300031548 Bacteria 1318
58 Ga0307405_10012085 3300031731 Bacteria 4554
59 Ga0307405_10025624 3300031731 Bacteria 3389
60 Ga0307405_10351171 3300031731 Bacteria 1137
61 Ga0307413_10004453 3300031824 Bacteria 6100
62 Ga0307413_10189965 3300031824 Bacteria 1474
63 Ga0307413_10548354 3300031824 Bacteria 937
64 Ga0307410_10036696 3300031852 Bacteria 3194
65 Ga0307410_10094024 3300031852 Bacteria 2134
66 Ga0307406_10062826 3300031901 Bacteria 2403
67 Ga0307406_10165945 3300031901 Bacteria 1593
68 Ga0307406_10392859 3300031901 Bacteria 1097
69 Ga0307406_10814021 3300031901 Bacteria 789
70 Ga0307407_10023880 3300031903 Bacteria 3196
71 Ga0307407_10122780 3300031903 Bacteria 1649
72 Ga0307407_10159005 3300031903 Bacteria 1477
73 Ga0307407_10174230 3300031903 Bacteria 1420
74 Ga0307407_10367410 3300031903 Bacteria 1023
75 Ga0307412_10024780 3300031911 Bacteria 3707
76 Ga0307412_10025244 3300031911 Bacteria 3678
77 Ga0307412_10040742 3300031911 Bacteria 3006
78 Ga0307412_10053862 3300031911 Bacteria 2668
79 Ga0307409_100028132 3300031995 Bacteria 3998
80 Ga0307409_100357054 3300031995 Bacteria 1381
81 Ga0307409_100479664 3300031995 Bacteria 1206
82 Ga0307416_100046917 3300032002 Bacteria 3414
83 Ga0307416_100118828 3300032002 Bacteria 2350
84 Ga0307416_100235665 3300032002 Bacteria 1768
85 Ga0307416_100711085 3300032002 Bacteria 1094
86 Ga0307416_100915366 3300032002 Bacteria 977
87 Ga0307416_101169901 3300032002 Bacteria 874
88 Ga0307414_10043080 3300032004 Bacteria 3072
89 Ga0307414_10244155 3300032004 Bacteria 1488
90 Ga0307411_10272248 3300032005 Bacteria 1343
91 Ga0307415_100578987 3300032126 Bacteria 995
92 Ga0307415_100654240 3300032126 Bacteria 942
93 Ga0307415_100657631 3300032126 Bacteria 940
94 Ga0373923_0213686 3300035111 Bacteria 895
95 Ga0373943_0485484 3300035170 Bacteria 721
96 Ga0316574_0013136 3300035398 Bacteria 4755
97 Ga0373935_0208865 3300035692 Bacteria 1352
98 Ga0373935_0664799 3300035692 Bacteria 765
99 Ga0373927_0071063 3300035695 Bacteria 2253
100 Ga0373933_0047332 3300035724 Bacteria 2557
101 Ga0373937_0141631 3300036401 Bacteria 2250
102 Ga0395899_0003181 3300037312 Bacteria 13028
103 Ga0395899_0159616 3300037312 Bacteria 1594
104 Ga0395900_0009661 3300037418 Bacteria 9890
105 Ga0395900_0540168 3300037418 Bacteria 1111
106 Ga0395900_0671903 3300037418 Bacteria 971
107 Ga0395898_0032637 3300037466 Bacteria 5198
108 Ga0395898_0113317 3300037466 Bacteria 2599
109 Ga0395898_0128963 3300037466 Bacteria 2423
110 Ga0395905_0029076 3300037471 Bacteria 5208
111 Ga0395905_0693608 3300037471 Bacteria 920
112 Ga0395901_0004212 3300038443 Bacteria 14496
113 Ga0395901_0028303 3300038443 Bacteria 5764
114 Ga0395901_0355032 3300038443 Bacteria 1512
115 Ga0439436_0011010 3300041404 Bacteria 2751
116 Ga0439439_0123170 3300041406 Bacteria 724
117 Ga0439433_0005900 3300041999 Bacteria 2630
118 Ga0439433_0017669 3300041999 Bacteria 1584
119 Ga0439442_000070 3300042002 Bacteria 24102
120 Ga0439449_0017415 3300042007 Bacteria 2698
121 Ga0439449_0032033 3300042007 Bacteria 1959
122 Ga0439457_024018 3300042014 Bacteria 1349
123 Ga0450920_000418 3300042122 Bacteria 6648
124 Ga0450920_000699 3300042122 Bacteria 5379
125 Ga0450920_015265 3300042122 Bacteria 1460
126 Ga0450907_010312 3300042146 Bacteria 1551
127 Ga0450908_032547 3300042184 Bacteria 905
128 Ga0450918_009330 3300042531 Bacteria 1721
129 Ga0451577_0210786 3300042876 Bacteria 1755
130 Ga0451577_0907500 3300042876 Unclassified 793
131 Ga0453684_0000003 3300044712 Bacteria 1481694
132 Ga0453684_0000056 3300044712 Bacteria 513389
133 Ga0453684_0000271 3300044712 Bacteria 223654
134 Ga0453684_0003711 3300044712 Bacteria 33819
135 Ga0453684_0014939 3300044712 Bacteria 12342
136 Ga0453684_0049434 3300044712 Bacteria 5546
137 Ga0453684_1504075 3300044712 Bacteria 694
138 Ga0451576_0007474 3300045051 Bacteria 13039
139 Ga0451576_0008633 3300045051 Bacteria 11935
140 Ga0495592_0096028 3300046454 Bacteria 2119
141 Ga0495594_0000006 3300046499 Bacteria 167901
142 Ga0495608_0572487 3300046511 Unclassified 679
143 Ga0495618_0117378 3300046514 Bacteria 1704
144 Ga0495628_0062602 3300046516 Bacteria 2916
145 Ga0495586_0193296 3300046535 Bacteria 1153
146 Ga0495645_0079852 3300046543 Bacteria 2349
147 Ga0495622_0000201 3300046557 Bacteria 47462
148 Ga0495599_0110010 3300046678 Bacteria 1717
149 Ga0495646_0196270 3300046680 Bacteria 1101
150 Ga0495674_0026902 3300047319 Bacteria 5261
151 Ga0495676_0292591 3300047321 Bacteria 1100
152 Ga0495684_0203426 3300047471 Bacteria 1459
153 Ga0495593_0331309 3300047673 Bacteria 761
154 Ga0496100_0559664 3300048903 Bacteria 885
155 Ga0496101_0801096 3300048904 Bacteria 743
156 Ga0496110_0654709 3300048913 Bacteria 950
157 Ga0496112_0067850 3300048915 Bacteria 3521
158 Ga0496113_0272110 3300048916 Bacteria 1354
159 Ga0496114_0194363 3300048917 Bacteria 1776
160 Ga0496115_0191135 3300048918 Bacteria 1691
161 Ga0496115_0350377 3300048918 Bacteria 1204
162 Ga0496126_0125698 3300048929 Bacteria 2220
163 Ga0501037_0181667 3300049573 Bacteria 1492
164 Ga0501071_0213092 3300049587 Bacteria 1453
165 Ga0501249_045402 3300049679 Bacteria 1003
166 Ga0501081_0254747 3300049743 Bacteria 1282
167 nmdc:mga03n38_119432_c1 3300050490 Bacteria 1293
168 nmdc:mga00v17_59153_c1 3300050491 Bacteria 2350
169 nmdc:mga07m45_142860_c1 3300050496 Bacteria 1386
170 nmdc:mga08y16_336800_c1 3300050511 Bacteria 1551
171 nmdc:mga0n895_517270_c1 3300050512 Bacteria 1201
172 Ga0587090_019143 3300059510 Bacteria 1053
173 Ga0587072_011729 3300059643 Bacteria 1437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10009726 Ga0207646_100097263 156
2 3300046511 Ga0495608_0572487 Ga0495608_0572487_183_662 156
3 3300005471 Ga0070698_100004506 Ga0070698_10000450615 175
4 3300025922 Ga0207646_10000034 Ga0207646_10000034129 175
5 3300035111 Ga0373923_0213686 Ga0373923_0213686_40_579 179
6 3300035170 Ga0373943_0485484 Ga0373943_0485484_140_679 179
7 3300035692 Ga0373935_0208865 Ga0373935_0208865_149_688 179
8 3300035695 Ga0373927_0071063 Ga0373927_0071063_1217_1756 179
9 3300035724 Ga0373933_0047332 Ga0373933_0047332_1910_2449 179
10 3300036401 Ga0373937_0141631 Ga0373937_0141631_613_1152 179
11 3300046514 Ga0495618_0117378 Ga0495618_0117378_1016_1555 179
12 3300046516 Ga0495628_0062602 Ga0495628_0062602_618_1157 179
13 3300046543 Ga0495645_0079852 Ga0495645_0079852_491_1030 179
14 3300046678 Ga0495599_0110010 Ga0495599_0110010_512_1051 179
15 3300046680 Ga0495646_0196270 Ga0495646_0196270_179_718 179
16 3300047319 Ga0495674_0026902 Ga0495674_0026902_4543_5082 179
17 3300047321 Ga0495676_0292591 Ga0495676_0292591_19_558 179
18 3300037312 Ga0395899_0159616 Ga0395899_0159616_865_1407 180
19 3300037418 Ga0395900_0009661 Ga0395900_0009661_4253_4795 180
20 3300037466 Ga0395898_0032637 Ga0395898_0032637_3768_4310 180
21 3300037471 Ga0395905_0029076 Ga0395905_0029076_1761_2303 180
22 3300038443 Ga0395901_0004212 Ga0395901_0004212_10103_10645 180
23 iso_pu_bacteria 2808606360 2808853363 180
24 iso_pu_bacteria 2808606366 2808878141 180
25 iso_pu_bacteria 2808606371 2808897351 180
26 iso_pu_bacteria 2690315906 2691514893 181
27 iso_pu_bacteria 2808606370 2808892249 181
28 iso_pu_bacteria 2945916053 2945917980 181
29 iso_pu_bacteria 2945920336 2945921731 181
30 iso_pu_bacteria 2946037020 2946038032 181
31 iso_pu_bacteria 2953998280 2953999315 181
32 iso_pu_bacteria 2899359706 2899364361 182
33 iso_pu_bacteria 2946059875 2946061816 182
34 3300050490 nmdc:mga03n38_119432_c1 nmdc:mga03n38_119432_c1_480_1043 183
35 3300005438 Ga0070701_10234711 Ga0070701_102347112 184
36 3300009148 Ga0105243_10120365 Ga0105243_101203652 184
37 3300013105 Ga0157369_10014543 Ga0157369_100145436 184
38 3300013105 Ga0157369_10181079 Ga0157369_101810792 184
39 3300014969 Ga0157376_10414726 Ga0157376_104147262 184
40 3300026088 Ga0207641_10401669 Ga0207641_104016691 184
41 3300046499 Ga0495594_0000006 Ga0495594_0000006_163113_163667 184
42 3300046557 Ga0495622_0000201 Ga0495622_0000201_35158_35712 184
43 3300048916 Ga0496113_0272110 Ga0496113_0272110_273_827 184
44 3300048918 Ga0496115_0191135 Ga0496115_0191135_571_1125 184
45 3300048929 Ga0496126_0125698 Ga0496126_0125698_1553_2107 184
46 3300049587 Ga0501071_0213092 Ga0501071_0213092_688_1242 184
47 iso_pu_bacteria 2939598168 2939598966 184
48 3300005288 Ga0065714_10037259 Ga0065714_100372591 185
49 3300005436 Ga0070713_101086748 Ga0070713_1010867481 185
50 3300005468 Ga0070707_100964198 Ga0070707_1009641981 185
51 3300005548 Ga0070665_100436071 Ga0070665_1004360712 185
52 3300006028 Ga0070717_10020777 Ga0070717_100207773 185
53 3300006038 Ga0075365_10064232 Ga0075365_100642322 185
54 3300006051 Ga0075364_10119056 Ga0075364_101190562 185
55 3300006844 Ga0075428_100023683 Ga0075428_1000236834 185
56 3300009094 Ga0111539_10813106 Ga0111539_108131062 185
57 3300025904 Ga0207647_10086910 Ga0207647_100869102 185
58 3300025922 Ga0207646_10793251 Ga0207646_107932511 185
59 3300028379 Ga0268266_10305303 Ga0268266_103053032 185
60 3300031548 Ga0307408_100028343 Ga0307408_1000283432 185
61 3300031548 Ga0307408_100048116 Ga0307408_1000481161 185
62 3300031548 Ga0307408_100117634 Ga0307408_1001176343 185
63 3300031548 Ga0307408_100313688 Ga0307408_1003136882 185
64 3300031731 Ga0307405_10012085 Ga0307405_100120852 185
65 3300031731 Ga0307405_10025624 Ga0307405_100256242 185
66 3300031731 Ga0307405_10351171 Ga0307405_103511712 185
67 3300031824 Ga0307413_10004453 Ga0307413_100044532 185
68 3300031824 Ga0307413_10189965 Ga0307413_101899651 185
69 3300031824 Ga0307413_10548354 Ga0307413_105483541 185
70 3300031852 Ga0307410_10036696 Ga0307410_100366963 185
71 3300031852 Ga0307410_10094024 Ga0307410_100940242 185
72 3300031901 Ga0307406_10062826 Ga0307406_100628261 185
73 3300031901 Ga0307406_10165945 Ga0307406_101659452 185
74 3300031903 Ga0307407_10023880 Ga0307407_100238802 185
75 3300031903 Ga0307407_10122780 Ga0307407_101227802 185
76 3300031903 Ga0307407_10159005 Ga0307407_101590051 185
77 3300031903 Ga0307407_10367410 Ga0307407_103674102 185
78 3300031911 Ga0307412_10024780 Ga0307412_100247802 185
79 3300031911 Ga0307412_10025244 Ga0307412_100252442 185
80 3300031911 Ga0307412_10040742 Ga0307412_100407423 185
81 3300031911 Ga0307412_10053862 Ga0307412_100538622 185
82 3300031995 Ga0307409_100028132 Ga0307409_1000281324 185
83 3300032002 Ga0307416_100046917 Ga0307416_1000469174 185
84 3300032002 Ga0307416_100118828 Ga0307416_1001188283 185
85 3300032002 Ga0307416_100235665 Ga0307416_1002356652 185
86 3300032002 Ga0307416_100711085 Ga0307416_1007110852 185
87 3300032002 Ga0307416_100915366 Ga0307416_1009153662 185
88 3300032002 Ga0307416_101169901 Ga0307416_1011699012 185
89 3300032004 Ga0307414_10043080 Ga0307414_100430803 185
90 3300032004 Ga0307414_10244155 Ga0307414_102441552 185
91 3300032005 Ga0307411_10272248 Ga0307411_102722482 185
92 3300032126 Ga0307415_100654240 Ga0307415_1006542402 185
93 3300032126 Ga0307415_100657631 Ga0307415_1006576311 185
94 3300035692 Ga0373935_0664799 Ga0373935_0664799_23_580 185
95 3300041404 Ga0439436_0011010 Ga0439436_0011010_449_1006 185
96 3300041406 Ga0439439_0123170 Ga0439439_0123170_29_586 185
97 3300041999 Ga0439433_0005900 Ga0439433_0005900_35_592 185
98 3300041999 Ga0439433_0017669 Ga0439433_0017669_321_887 185
99 3300042002 Ga0439442_000070 Ga0439442_000070_9173_9730 185
100 3300042007 Ga0439449_0017415 Ga0439449_0017415_1531_2088 185
101 3300042007 Ga0439449_0032033 Ga0439449_0032033_314_871 185
102 3300042014 Ga0439457_024018 Ga0439457_024018_603_1160 185
103 3300042122 Ga0450920_000418 Ga0450920_000418_192_749 185
104 3300042122 Ga0450920_000699 Ga0450920_000699_4564_5130 185
105 3300042122 Ga0450920_015265 Ga0450920_015265_289_846 185
106 3300042146 Ga0450907_010312 Ga0450907_010312_857_1414 185
107 3300042184 Ga0450908_032547 Ga0450908_032547_146_703 185
108 3300042531 Ga0450918_009330 Ga0450918_009330_65_622 185
109 3300044712 Ga0453684_0000271 Ga0453684_0000271_190545_191102 185
110 3300046454 Ga0495592_0096028 Ga0495592_0096028_36_593 185
111 3300046535 Ga0495586_0193296 Ga0495586_0193296_431_988 185
112 3300047471 Ga0495684_0203426 Ga0495684_0203426_360_917 185
113 3300048903 Ga0496100_0559664 Ga0496100_0559664_129_686 185
114 3300048904 Ga0496101_0801096 Ga0496101_0801096_55_612 185
115 3300048913 Ga0496110_0654709 Ga0496110_0654709_201_758 185
116 3300048915 Ga0496112_0067850 Ga0496112_0067850_1161_1718 185
117 3300048917 Ga0496114_0194363 Ga0496114_0194363_248_805 185
118 3300048918 Ga0496115_0350377 Ga0496115_0350377_350_907 185
119 3300049573 Ga0501037_0181667 Ga0501037_0181667_886_1443 185
120 3300050491 nmdc:mga00v17_59153_c1 nmdc:mga00v17_59153_c1_883_1446 185
121 3300050496 nmdc:mga07m45_142860_c1 nmdc:mga07m45_142860_c1_779_1336 185
122 3300050511 nmdc:mga08y16_336800_c1 nmdc:mga08y16_336800_c1_229_786 185
123 3300003373 JGI25407J50210_10062748 JGI25407J50210_100627482 186
124 3300005467 Ga0070706_100068437 Ga0070706_1000684374 186
125 3300005981 Ga0081538_10000026 Ga0081538_1000002624 186
126 3300006871 Ga0075434_100371907 Ga0075434_1003719072 186
127 3300025910 Ga0207684_10009636 Ga0207684_100096367 186
128 3300031995 Ga0307409_100357054 Ga0307409_1003570542 186
129 3300032126 Ga0307415_100578987 Ga0307415_1005789872 186
130 3300035398 Ga0316574_0013136 Ga0316574_0013136_2068_2628 186
131 3300037312 Ga0395899_0003181 Ga0395899_0003181_11233_11796 186
132 3300037418 Ga0395900_0540168 Ga0395900_0540168_51_611 186
133 3300037466 Ga0395898_0128963 Ga0395898_0128963_1739_2308 186
134 3300037471 Ga0395905_0693608 Ga0395905_0693608_182_742 186
135 3300038443 Ga0395901_0355032 Ga0395901_0355032_501_1061 186
136 3300042876 Ga0451577_0210786 Ga0451577_0210786_244_804 186
137 3300044712 Ga0453684_0049434 Ga0453684_0049434_4339_4899 186
138 3300047673 Ga0495593_0331309 Ga0495593_0331309_126_686 186
139 3300050512 nmdc:mga0n895_517270_c1 nmdc:mga0n895_517270_c1_520_1080 186
140 3300003316 rootH1_10041039 rootH1_100410391 187
141 3300003320 rootH2_10054335 rootH2_100543352 187
142 3300003322 rootL2_10216735 rootL2_102167352 187
143 3300005438 Ga0070701_10299747 Ga0070701_102997471 187
144 3300005440 Ga0070705_100260472 Ga0070705_1002604722 187
145 3300005441 Ga0070700_100746561 Ga0070700_1007465611 187
146 3300005467 Ga0070706_100249115 Ga0070706_1002491151 187
147 3300005471 Ga0070698_100140401 Ga0070698_1001404011 187
148 3300005518 Ga0070699_100018080 Ga0070699_1000180804 187
149 3300005536 Ga0070697_100588964 Ga0070697_1005889642 187
150 3300005545 Ga0070695_100092442 Ga0070695_1000924422 187
151 3300005549 Ga0070704_100033319 Ga0070704_1000333192 187
152 3300005617 Ga0068859_101224950 Ga0068859_1012249501 187
153 3300006852 Ga0075433_10554878 Ga0075433_105548782 187
154 3300006880 Ga0075429_100158802 Ga0075429_1001588021 187
155 3300006931 Ga0097620_101224840 Ga0097620_1012248401 187
156 3300009147 Ga0114129_11688268 Ga0114129_116882681 187
157 3300009176 Ga0105242_10394322 Ga0105242_103943222 187
158 3300009553 Ga0105249_10184077 Ga0105249_101840771 187
159 3300011119 Ga0105246_10107567 Ga0105246_101075673 187
160 3300013297 Ga0157378_10618332 Ga0157378_106183322 187
161 3300014325 Ga0163163_10621771 Ga0163163_106217711 187
162 3300025934 Ga0207686_10652375 Ga0207686_106523751 187
163 3300025961 Ga0207712_10824036 Ga0207712_108240362 187
164 3300026075 Ga0207708_10008577 Ga0207708_100085774 187
165 3300026118 Ga0207675_100300991 Ga0207675_1003009912 187
166 3300028380 Ga0268265_10405147 Ga0268265_104051472 187
167 3300031901 Ga0307406_10392859 Ga0307406_103928591 187
168 3300031901 Ga0307406_10814021 Ga0307406_108140212 187
169 3300031903 Ga0307407_10174230 Ga0307407_101742302 187
170 3300031995 Ga0307409_100479664 Ga0307409_1004796641 187
171 3300037418 Ga0395900_0671903 Ga0395900_0671903_303_866 187
172 3300037466 Ga0395898_0113317 Ga0395898_0113317_1893_2456 187
173 3300038443 Ga0395901_0028303 Ga0395901_0028303_3058_3621 187
174 3300042876 Ga0451577_0907500 Ga0451577_0907500_81_653 187
175 3300044712 Ga0453684_0000003 Ga0453684_0000003_1000414_1000986 187
176 3300044712 Ga0453684_0000056 Ga0453684_0000056_82320_82907 187
177 3300044712 Ga0453684_0003711 Ga0453684_0003711_1797_2369 187
178 3300044712 Ga0453684_0014939 Ga0453684_0014939_1555_2127 187
179 3300044712 Ga0453684_1504075 Ga0453684_1504075_76_648 187
180 3300045051 Ga0451576_0007474 Ga0451576_0007474_3191_3763 187
181 3300045051 Ga0451576_0008633 Ga0451576_0008633_2990_3562 187
182 3300049679 Ga0501249_045402 Ga0501249_045402_120_695 187
183 3300049743 Ga0501081_0254747 Ga0501081_0254747_534_1109 187
184 3300059510 Ga0587090_019143 Ga0587090_019143_185_748 187
185 3300059643 Ga0587072_011729 Ga0587072_011729_241_804 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

179

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8205 2 185
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8159 2 185
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8086 1 183
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.804 2 183
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7988 3 186
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8018 2 187 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7979 3 182 3.40.430.10
af_Q4DZ91_511_627_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.792 162 184 3.30.70.240
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7897 3 184 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7889 2 187 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2N3YZ04-F1-model_v4 deleted 0.9849 1 186
AF-A0A7V9R701-F1-model_v4 Dihydrofolate reductase family protein 0.9803 1 187 GO:0008703
GO:0009231
AF-A0A2N3YZ04-F1-model_v4 deleted 0.9797 1 186
AF-A0A2M9D158-F1-model_v4 Dihydrofolate reductase 0.9783 3 185 GO:0008703
GO:0009231
AF-A0A536R3V8-F1-model_v4 Deaminase 0.9777 1 164 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
95.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map