F284717

General Info

Members Datasets Scaffolds Average Seq Length
185 106 370 203

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0825547|Ga0436361_0825547_1920_2630
Length 236
Sequence VSKSGTGVSPVPLISQARPEKKFRLECAGLMLHLLKHPLSEHVVTHLRDRTTKPATFRTLSYQISLLLAFEATRNFATREAIVETPLEKYTGRVLAEPTVLVPILRAGISMVQPFADLLPEVSVGYIGLERDEETAVARSYYSKLPPLAARRVLILDPMLATGGSAVQAIQVVAAHGAATKDLALVSIVAAPEGVRAVEAVDPRISIFTAALDRELNARKYILPGLGDFGDRLYGT

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
60 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
63 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
64 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
65 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
66 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
102 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 1.62
Rhizosphere 86.49
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0825547 3300039447 Unclassified 3098
2 rootH2_10035167 3300003320 Bacteria 7348
3 rootL2_10023585 3300003322 Bacteria 4274
4 JGI25407J50210_10005960 3300003373 Bacteria 3017
5 Ga0070658_10004350 3300005327 Bacteria 11561
6 Ga0070658_10011318 3300005327 Bacteria 7154
7 Ga0070709_10055648 3300005434 Bacteria 2498
8 Ga0070713_100042570 3300005436 Bacteria 3708
9 Ga0070708_100007329 3300005445 Bacteria 8826
10 Ga0070708_100030220 3300005445 Bacteria 4682
11 Ga0070708_100136513 3300005445 Bacteria 2272
12 Ga0070681_10528355 3300005458 Bacteria 1093
13 Ga0070706_100177484 3300005467 Unclassified 1989
14 Ga0070707_101032651 3300005468 Unclassified 787
15 Ga0070698_100079859 3300005471 Bacteria 3267
16 Ga0070698_100102839 3300005471 Unclassified 2827
17 Ga0070699_100025378 3300005518 Bacteria 5109
18 Ga0070699_100088435 3300005518 Unclassified 2706
19 Ga0070679_100020167 3300005530 Bacteria 6497
20 Ga0070697_100161481 3300005536 Unclassified 1893
21 Ga0070697_101218119 3300005536 Bacteria 671
22 Ga0068860_100742991 3300005843 Bacteria 992
23 Ga0081538_10000007 3300005981 Bacteria 175313
24 Ga0070717_10198224 3300006028 Bacteria 1757
25 Ga0070715_10282068 3300006163 Bacteria 881
26 Ga0070712_100497706 3300006175 Bacteria 1021
27 Ga0105238_10513464 3300009551 Bacteria 1200
28 Ga0105239_10039511 3300010375 Bacteria 5169
29 Ga0157374_10093707 3300013296 Bacteria 2868
30 Ga0213872_10000870 3300021361 Bacteria 21851
31 Ga0213872_10026165 3300021361 Bacteria 2681
32 Ga0213872_10067695 3300021361 Bacteria 1611
33 Ga0213874_10047737 3300021377 Bacteria 1304
34 Ga0213876_10001659 3300021384 Bacteria 13581
35 Ga0213876_10025814 3300021384 Unclassified 3097
36 Ga0213875_10005056 3300021388 Bacteria 7143
37 Ga0213871_10001171 3300021441 Unclassified 4206
38 Ga0213871_10037140 3300021441 Bacteria 1295
39 Ga0207705_10009187 3300025909 Bacteria 7200
40 Ga0207705_10021364 3300025909 Bacteria 4619
41 Ga0207652_10057259 3300025921 Bacteria 3357
42 Ga0207646_10102711 3300025922 Unclassified 2563
43 Ga0207700_10305621 3300025928 Bacteria 1374
44 Ga0207667_11441860 3300025949 Bacteria 661
45 Ga0265319_1000040 3300028563 Bacteria 112246
46 Ga0265319_1013883 3300028563 Bacteria 3183
47 Ga0265319_1055771 3300028563 Bacteria 1292
48 Ga0265334_10013556 3300028573 Bacteria 3410
49 Ga0265334_10083482 3300028573 Bacteria 1174
50 Ga0265318_10000844 3300028577 Bacteria 20145
51 Ga0265323_10000064 3300028653 Bacteria 57250
52 Ga0265323_10003778 3300028653 Bacteria 6602
53 Ga0265323_10006569 3300028653 Bacteria 4883
54 Ga0265323_10014551 3300028653 Bacteria 3112
55 Ga0265323_10033599 3300028653 Bacteria 1898
56 Ga0265323_10034714 3300028653 Bacteria 1862
57 Ga0265323_10089073 3300028653 Bacteria 1033
58 Ga0265322_10000649 3300028654 Bacteria 13069
59 Ga0265322_10001605 3300028654 Bacteria 7235
60 Ga0265322_10071691 3300028654 Bacteria 983
61 Ga0265338_10007420 3300028800 Bacteria 13611
62 Ga0265324_10047046 3300029957 Bacteria 1485
63 Ga0265330_10003050 3300031235 Bacteria 8880
64 Ga0265330_10058741 3300031235 Bacteria 1676
65 Ga0265330_10157329 3300031235 Bacteria 965
66 Ga0265330_10201572 3300031235 Bacteria 841
67 Ga0265332_10034462 3300031238 Bacteria 2200
68 Ga0265332_10057425 3300031238 Unclassified 1667
69 Ga0265332_10060153 3300031238 Bacteria 1626
70 Ga0265328_10101423 3300031239 Bacteria 1066
71 Ga0265320_10037946 3300031240 Bacteria 2422
72 Ga0265320_10047563 3300031240 Bacteria 2097
73 Ga0265320_10051566 3300031240 Bacteria 1995
74 Ga0265340_10167473 3300031247 Bacteria 996
75 Ga0265339_10160027 3300031249 Bacteria 1133
76 Ga0265331_10009023 3300031250 Bacteria 5634
77 Ga0265331_10119830 3300031250 Bacteria 1204
78 Ga0265327_10001524 3300031251 Bacteria 28621
79 Ga0265327_10027744 3300031251 Bacteria 3252
80 Ga0265327_10034352 3300031251 Bacteria 2815
81 Ga0265327_10078637 3300031251 Bacteria 1633
82 Ga0265327_10205578 3300031251 Bacteria 890
83 Ga0265316_10001079 3300031344 Bacteria 29504
84 Ga0265316_10014989 3300031344 Bacteria 6797
85 Ga0265316_10033345 3300031344 Bacteria 4194
86 Ga0265316_10090906 3300031344 Bacteria 2329
87 Ga0265316_10257907 3300031344 Bacteria 1279
88 Ga0265316_10404268 3300031344 Bacteria 983
89 Ga0265314_10003079 3300031711 Bacteria 16442
90 Ga0265314_10200719 3300031711 Bacteria 1179
91 Ga0265342_10075732 3300031712 Bacteria 1951
92 Ga0373935_0278977 3300035692 Bacteria 1176
93 Ga0395905_0000030 3300037471 Bacteria 289430
94 Ga0436364_0858694 3300037853 Bacteria 21295
95 Ga0436364_1383729 3300037853 Bacteria 2196
96 Ga0436364_1483566 3300037853 Bacteria 5065
97 Ga0436364_1529455 3300037853 Bacteria 2412
98 Ga0242420_026357 3300038996 Bacteria 1060
99 Ga0436365_0452271 3300039437 Bacteria 5896
100 Ga0436365_0763619 3300039437 Bacteria 54172
101 Ga0436365_1719943 3300039437 Bacteria 20997
102 Ga0436360_1175603 3300039438 Unclassified 4468
103 Ga0436360_1228768 3300039438 Unclassified 3705
104 Ga0436360_1246228 3300039438 Bacteria 4538
105 Ga0436360_1277737 3300039438 Bacteria 3861
106 Ga0436361_0256085 3300039447 Bacteria 7178
107 Ga0436361_0356802 3300039447 Bacteria 7782
108 Ga0436361_0480671 3300039447 Bacteria 2971
109 Ga0436361_0832091 3300039447 Bacteria 3673
110 Ga0436361_0870387 3300039447 Bacteria 7474
111 Ga0436361_1134333 3300039447 Bacteria 8214
112 Ga0436363_1500255 3300039450 Bacteria 3065
113 Ga0436362_0390612 3300039453 Unclassified 698
114 Ga0436362_0737447 3300039453 Bacteria 2119
115 Ga0436362_0887848 3300039453 Bacteria 1353
116 Ga0436362_0993789 3300039453 Unclassified 1066
117 Ga0451793_1605112 3300041452 Bacteria 1742
118 Ga0451802_1781709 3300041460 Bacteria 1974
119 Ga0451835_0928638 3300041492 Bacteria 1765
120 Ga0451839_0956037 3300041496 Bacteria 2587
121 Ga0451849_1122739 3300041505 Bacteria 1501
122 Ga0451851_1181829 3300041507 Bacteria 808
123 Ga0451855_0183766 3300041511 Bacteria 2097
124 Ga0451577_0201178 3300042876 Bacteria 1798
125 Ga0466966_0081668 3300044684 Unclassified 2012
126 Ga0466961_0126016 3300044693 Bacteria 1607
127 Ga0466961_0228698 3300044693 Bacteria 1145
128 Ga0466963_0058672 3300044694 Bacteria 2567
129 Ga0466963_0356076 3300044694 Bacteria 1031
130 Ga0453684_0000559 3300044712 Bacteria 140441
131 Ga0453684_0010650 3300044712 Bacteria 15659
132 Ga0453684_0036965 3300044712 Bacteria 6713
133 Ga0453684_0914896 3300044712 Bacteria 938
134 Ga0466971_0067203 3300044719 Bacteria 1625
135 Ga0466957_0074039 3300044842 Bacteria 2112
136 Ga0466957_0194148 3300044842 Bacteria 1331
137 Ga0466959_0131022 3300045049 Bacteria 1777
138 Ga0466959_0221826 3300045049 Bacteria 1311
139 Ga0466959_0264923 3300045049 Bacteria 1182
140 Ga0451576_0000548 3300045051 Bacteria 80649
141 Ga0451576_0214078 3300045051 Unclassified 2012
142 Ga0451576_1324523 3300045051 Bacteria 750
143 Ga0466958_0013326 3300045836 Bacteria 4679
144 Ga0495586_0212605 3300046535 Bacteria 1098
145 Ga0496112_0338699 3300048915 Bacteria 1448
146 Ga0501031_0102495 3300049568 Bacteria 1867
147 Ga0501032_0001775 3300049569 Bacteria 17026
148 Ga0501033_0002289 3300049570 Bacteria 16376
149 Ga0501034_0021175 3300049571 Bacteria 6632
150 Ga0501034_0024039 3300049571 Bacteria 6200
151 Ga0501034_0099277 3300049571 Bacteria 2906
152 Ga0501036_0038047 3300049572 Bacteria 4070
153 Ga0501036_0232638 3300049572 Unclassified 1546
154 Ga0501037_0034333 3300049573 Bacteria 3742
155 Ga0501037_0052453 3300049573 Bacteria 2983
156 Ga0501038_0030891 3300049574 Bacteria 4735
157 Ga0501038_0261142 3300049574 Bacteria 1369
158 Ga0501039_0068184 3300049575 Bacteria 2762
159 Ga0501039_0402728 3300049575 Bacteria 1075
160 Ga0501042_0187156 3300049578 Bacteria 1493
161 Ga0501043_0089416 3300049579 Bacteria 2420
162 Ga0501046_0223398 3300049580 Bacteria 1393
163 Ga0501047_0181260 3300049581 Bacteria 1972
164 Ga0501047_0360518 3300049581 Bacteria 1289
165 Ga0501048_0062027 3300049582 Bacteria 2646
166 Ga0501068_0142093 3300049584 Bacteria 1505
167 Ga0501070_0072013 3300049586 Bacteria 2861
168 Ga0501070_0450726 3300049586 Bacteria 1037
169 Ga0501072_0860724 3300049588 Bacteria 709
170 Ga0501073_0013761 3300049589 Bacteria 5884
171 Ga0501080_0439605 3300049742 Bacteria 1170
172 Ga0501081_0444935 3300049743 Bacteria 962
173 Ga0501083_0000526 3300049744 Bacteria 24451
174 Ga0501083_0026920 3300049744 Bacteria 3972
175 Ga0501083_0177223 3300049744 Bacteria 1392
176 Ga0501035_0003812 3300049822 Bacteria 14369
177 Ga0501044_0007460 3300049823 Bacteria 12028
178 Ga0500568_0036632 3300053139 Bacteria 1995
179 Ga0500588_0085793 3300053146 Bacteria 1062
180 Ga0500622_0020672 3300053156 Bacteria 3495
181 Ga0501084_0227654 3300054114 Unclassified 1573
182 Ga0590075_021240 3300059424 Bacteria 1618
183 Ga0501082_0066411 3300060353 Bacteria 3107
184 Ga0501082_0149769 3300060353 Unclassified 2026
185 Ga0501082_0299271 3300060353 Bacteria 1401
186 Ga0436361_0825547
187 rootH2_10035167
188 rootL2_10023585
189 JGI25407J50210_10005960
190 Ga0070658_10004350
191 Ga0070658_10011318
192 Ga0070709_10055648
193 Ga0070713_100042570
194 Ga0070708_100007329
195 Ga0070708_100030220
196 Ga0070708_100136513
197 Ga0070681_10528355
198 Ga0070706_100177484
199 Ga0070707_101032651
200 Ga0070698_100079859
201 Ga0070698_100102839
202 Ga0070699_100025378
203 Ga0070699_100088435
204 Ga0070679_100020167
205 Ga0070697_100161481
206 Ga0070697_101218119
207 Ga0068860_100742991
208 Ga0081538_10000007
209 Ga0070717_10198224
210 Ga0070715_10282068
211 Ga0070712_100497706
212 Ga0105238_10513464
213 Ga0105239_10039511
214 Ga0157374_10093707
215 Ga0213872_10000870
216 Ga0213872_10026165
217 Ga0213872_10067695
218 Ga0213874_10047737
219 Ga0213876_10001659
220 Ga0213876_10025814
221 Ga0213875_10005056
222 Ga0213871_10001171
223 Ga0213871_10037140
224 Ga0207705_10009187
225 Ga0207705_10021364
226 Ga0207652_10057259
227 Ga0207646_10102711
228 Ga0207700_10305621
229 Ga0207667_11441860
230 Ga0265319_1000040
231 Ga0265319_1013883
232 Ga0265319_1055771
233 Ga0265334_10013556
234 Ga0265334_10083482
235 Ga0265318_10000844
236 Ga0265323_10000064
237 Ga0265323_10003778
238 Ga0265323_10006569
239 Ga0265323_10014551
240 Ga0265323_10033599
241 Ga0265323_10034714
242 Ga0265323_10089073
243 Ga0265322_10000649
244 Ga0265322_10001605
245 Ga0265322_10071691
246 Ga0265338_10007420
247 Ga0265324_10047046
248 Ga0265330_10003050
249 Ga0265330_10058741
250 Ga0265330_10157329
251 Ga0265330_10201572
252 Ga0265332_10034462
253 Ga0265332_10057425
254 Ga0265332_10060153
255 Ga0265328_10101423
256 Ga0265320_10037946
257 Ga0265320_10047563
258 Ga0265320_10051566
259 Ga0265340_10167473
260 Ga0265339_10160027
261 Ga0265331_10009023
262 Ga0265331_10119830
263 Ga0265327_10001524
264 Ga0265327_10027744
265 Ga0265327_10034352
266 Ga0265327_10078637
267 Ga0265327_10205578
268 Ga0265316_10001079
269 Ga0265316_10014989
270 Ga0265316_10033345
271 Ga0265316_10090906
272 Ga0265316_10257907
273 Ga0265316_10404268
274 Ga0265314_10003079
275 Ga0265314_10200719
276 Ga0265342_10075732
277 Ga0373935_0278977
278 Ga0395905_0000030
279 Ga0436364_0858694
280 Ga0436364_1383729
281 Ga0436364_1483566
282 Ga0436364_1529455
283 Ga0242420_026357
284 Ga0436365_0452271
285 Ga0436365_0763619
286 Ga0436365_1719943
287 Ga0436360_1175603
288 Ga0436360_1228768
289 Ga0436360_1246228
290 Ga0436360_1277737
291 Ga0436361_0256085
292 Ga0436361_0356802
293 Ga0436361_0480671
294 Ga0436361_0832091
295 Ga0436361_0870387
296 Ga0436361_1134333
297 Ga0436363_1500255
298 Ga0436362_0390612
299 Ga0436362_0737447
300 Ga0436362_0887848
301 Ga0436362_0993789
302 Ga0451793_1605112
303 Ga0451802_1781709
304 Ga0451835_0928638
305 Ga0451839_0956037
306 Ga0451849_1122739
307 Ga0451851_1181829
308 Ga0451855_0183766
309 Ga0451577_0201178
310 Ga0466966_0081668
311 Ga0466961_0126016
312 Ga0466961_0228698
313 Ga0466963_0058672
314 Ga0466963_0356076
315 Ga0453684_0000559
316 Ga0453684_0010650
317 Ga0453684_0036965
318 Ga0453684_0914896
319 Ga0466971_0067203
320 Ga0466957_0074039
321 Ga0466957_0194148
322 Ga0466959_0131022
323 Ga0466959_0221826
324 Ga0466959_0264923
325 Ga0451576_0000548
326 Ga0451576_0214078
327 Ga0451576_1324523
328 Ga0466958_0013326
329 Ga0495586_0212605
330 Ga0496112_0338699
331 Ga0501031_0102495
332 Ga0501032_0001775
333 Ga0501033_0002289
334 Ga0501034_0021175
335 Ga0501034_0024039
336 Ga0501034_0099277
337 Ga0501036_0038047
338 Ga0501036_0232638
339 Ga0501037_0034333
340 Ga0501037_0052453
341 Ga0501038_0030891
342 Ga0501038_0261142
343 Ga0501039_0068184
344 Ga0501039_0402728
345 Ga0501042_0187156
346 Ga0501043_0089416
347 Ga0501046_0223398
348 Ga0501047_0181260
349 Ga0501047_0360518
350 Ga0501048_0062027
351 Ga0501068_0142093
352 Ga0501070_0072013
353 Ga0501070_0450726
354 Ga0501072_0860724
355 Ga0501073_0013761
356 Ga0501080_0439605
357 Ga0501081_0444935
358 Ga0501083_0000526
359 Ga0501083_0026920
360 Ga0501083_0177223
361 Ga0501035_0003812
362 Ga0501044_0007460
363 Ga0500568_0036632
364 Ga0500588_0085793
365 Ga0500622_0020672
366 Ga0501084_0227654
367 Ga0590075_021240
368 Ga0501082_0066411
369 Ga0501082_0149769
370 Ga0501082_0299271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14681

UPRTase

Uracil phosphoribosyltransferase

34

236

0.98

PF00156

Pribosyltran

Phosphoribosyl transferase domain

77

215

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5o-assembly1.cif.gz_B crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution 0.977 2 205
6wn8-assembly3.cif.gz_I 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9735 1 205
6wn8-assembly3.cif.gz_I 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9689 1 205
1v9s-assembly1.cif.gz_C crystal structure of tt0130 protein from thermus thermophilus hb8 0.968 1 205
1o5o-assembly1.cif.gz_B crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution 0.9677 2 205
ID Description Score Start End Superfamily
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9748 1 205 3.40.50.2020
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9702 1 205 3.40.50.2020
af_B6U5U2_13_228_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.965 2 205 3.40.50.2020
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9608 3 205 3.40.50.2020
af_B6U5U2_13_228_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9558 2 205 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A645IBZ4-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 1.001 130 205 GO:0004845
AF-A0A662F2M2-F1-model_v4 uracil phosphoribosyltransferase (EC 2.4.2.9) 0.997 115 205 GO:0004845
GO:0005525
GO:0016020
AF-A0A062G075-F1-model_v4 Phosphoribosyl transferase domain protein 0.9966 127 205 GO:0016740
AF-A0A352IVC0-F1-model_v4 Uracil phosphoribosyltransferase 0.9948 125 205 GO:0016757
AF-A0A3B8V2U3-F1-model_v4 Uracil phosphoribosyltransferase 0.9945 119 205 GO:0016757

Map