F284564

General Info

Members Datasets Scaffolds Average Seq Length
185 151 177 331

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10163722|Ga0307513_101637222
Length 346
Sequence MKAFLLRRDACGTRGRSAAFGTWAVAAALVLAALSPAVQAQTKLPLRISTPAVPDDWHAKMWTVFKESLEKSAPGEFDVQINLNASLFKQGTEPAAMARGNLELASISAFDIAKLIPEFSIFTAGYIVRDPDHQQKVFNGPIGDEMFKLVADKMDVTVLSTIYLGTRQVNLRDARNVRTPADLKGVKLRMPGSKEWLFLGEALGATATPLAFGEVYLGLKTGTIDGQDNPLPTVRAAKFYEVTKQLVMTSHLVDGIFISISNKRWNALNAAQKHKVKAAAQAATAYNNENRLKEEAQLVDFFKQQGLQVVTPDIGAFRKTVQAAYAASEMAKAWPKGMLERINATP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
9 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
96 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
110 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
142 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
143 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
144 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
145 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
146 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
149 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 1.08
Isolates 4.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.54
Nodule 0.54
Rhizoplane 3.78
Rhizosphere 41.62
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000343 3300002704 Bacteria 14955
2 JGI25156J39149_1000142 3300002705 Bacteria 52807
3 JGI25154J39366_1000036 3300002738 Bacteria 161697
4 JGI25157J39369_1000023 3300002741 Bacteria 161697
5 JGI25152J39213_1001805 3300002773 Bacteria 8667
6 JGI25150J39212_1006670 3300002774 Bacteria 2364
7 JGI25159J45721_1003880 3300002987 Bacteria 5118
8 JGI25159J45721_1004622 3300002987 Bacteria 4513
9 JGI25151J46595_10015908 3300003187 Bacteria 3301
10 JGI25153J46596_10003430 3300003215 Bacteria 8878
11 JGI25153J46596_10005507 3300003215 Bacteria 6627
12 rootH1_10032003 3300003316 Bacteria 2548
13 rootH1_10032003 3300003323 Bacteria 5324
14 JGI25160J50197_1000283 3300003354 Bacteria 36700
15 JGI25160J50197_1000291 3300003354 Bacteria 36039
16 JGI25161J50226_1000015 3300003374 Bacteria 183773
17 Ga0055526_1002664 3300003771 Bacteria 11917
18 Ga0055537_1001270 3300003773 Bacteria 10503
19 Ga0055524_1000332 3300003775 Bacteria 43781
20 Ga0055534_1009557 3300003784 Bacteria 2098
21 Ga0055528_1007574 3300003790 Bacteria 4782
22 Ga0055530_10004046 3300003791 Bacteria 7871
23 Ga0055530_10012263 3300003791 Bacteria 3001
24 Ga0055540_1000144 3300003792 Bacteria 71420
25 Ga0055531_10025858 3300003794 Bacteria 2115
26 Ga0055543_1000611 3300004625 Bacteria 19291
27 Ga0065165_1011368 3300005262 Bacteria 3724
28 Ga0065165_1015519 3300005262 Bacteria 2898
29 Ga0065165_1016063 3300005262 Bacteria 2821
30 Ga0065165_1022847 3300005262 Bacteria 2133
31 Ga0070683_100463885 3300005329 Bacteria 1209
32 Ga0070668_100299205 3300005347 Bacteria 1349
33 Ga0070694_100328767 3300005444 Bacteria 1178
34 Ga0070681_10000525 3300005458 Bacteria 31394
35 Ga0068853_100130647 3300005539 Bacteria 2248
36 Ga0070695_100095000 3300005545 Bacteria 1997
37 Ga0068861_100029226 3300005719 Bacteria 4030
38 Ga0068860_100000101 3300005843 Bacteria 142856
39 Ga0081540_1096869 3300005983 Bacteria 1282
40 Ga0075364_10044463 3300006051 Bacteria 2888
41 Ga0075432_10002792 3300006058 Bacteria 5859
42 Ga0075366_10008861 3300006195 Bacteria 5606
43 Ga0075366_10061513 3300006195 Bacteria 2231
44 Ga0075370_10027539 3300006353 Bacteria 3154
45 Ga0075436_100131886 3300006914 Bacteria 1752
46 Ga0079104_1005465 3300006946 Bacteria 5068
47 Ga0114129_10746761 3300009147 Bacteria 1253
48 Ga0163163_10185525 3300014325 Bacteria 2128
49 Ga0157379_10057164 3300014968 Bacteria 3486
50 Ga0157379_10162198 3300014968 Bacteria 2018
51 Ga0209435_100001 3300025206 Bacteria 1424171
52 Ga0207425_1006248 3300025245 Bacteria 3279
53 Ga0207425_1007708 3300025245 Bacteria 2813
54 Ga0209646_1000001 3300025246 Bacteria 3092932
55 Ga0209026_1000003 3300025250 Bacteria 1060571
56 Ga0209759_1000001 3300025256 Bacteria 2799452
57 Ga0209129_1000212 3300025258 Bacteria 67061
58 Ga0209565_1000004 3300025263 Bacteria 983150
59 Ga0209673_1000045 3300025273 Bacteria 290531
60 Ga0209673_1019555 3300025273 Bacteria 2426
61 Ga0209130_1000056 3300025284 Bacteria 210851
62 Ga0209130_1000413 3300025284 Bacteria 46570
63 Ga0209675_1000185 3300025291 Bacteria 68701
64 Ga0209676_1000007 3300025292 Bacteria 1029371
65 Ga0209676_1005665 3300025292 Bacteria 6428
66 Ga0209025_1001312 3300025294 Bacteria 33868
67 Ga0209025_1007845 3300025294 Bacteria 7837
68 Ga0209564_1000024 3300025295 Bacteria 535041
69 Ga0209564_1002580 3300025295 Bacteria 13924
70 Ga0209564_1004945 3300025295 Bacteria 7874
71 Ga0209758_1000248 3300025297 Bacteria 110671
72 Ga0209758_1000558 3300025297 Bacteria 58712
73 Ga0209758_1009709 3300025297 Bacteria 5917
74 Ga0209050_1000003 3300025298 Bacteria 1609245
75 Ga0209050_1000222 3300025298 Bacteria 126562
76 Ga0209050_1009131 3300025298 Bacteria 5140
77 Ga0209256_1000001 3300025299 Bacteria 2166974
78 Ga0209256_1031789 3300025299 Bacteria 1438
79 Ga0207426_1000025 3300025302 Bacteria 532921
80 Ga0209051_1000003 3300025303 Bacteria 1609245
81 Ga0209051_1046636 3300025303 Bacteria 1488
82 Ga0209257_1000020 3300025304 Bacteria 773356
83 Ga0207707_10008578 3300025912 Bacteria 8861
84 Ga0207665_10052467 3300025939 Bacteria 2747
85 Ga0207668_10273056 3300025972 Bacteria 1383
86 Ga0207639_10048168 3300026041 Bacteria 3224
87 Ga0207675_100353391 3300026118 Bacteria 1441
88 Ga0209995_1010451 3300027471 Bacteria 1505
89 Ga0209588_1003806 3300027671 Bacteria 4208
90 Ga0307517_10113154 3300028786 Bacteria 2050
91 Ga0265332_10000005 3300031238 Bacteria 377525
92 Ga0265331_10005217 3300031250 Bacteria 7875
93 Ga0307513_10000120 3300031456 Bacteria 110390
94 Ga0307513_10159430 3300031456 Bacteria 2151
95 Ga0307513_10163722 3300031456 Bacteria 2112
96 Ga0307509_10087150 3300031507 Bacteria 3208
97 Ga0307408_100161268 3300031548 Bacteria 1781
98 Ga0265313_10002430 3300031595 Bacteria 16074
99 Ga0265342_10012949 3300031712 Bacteria 5623
100 Ga0307516_10012577 3300031730 Bacteria 9108
101 Ga0307516_10241677 3300031730 Bacteria 1504
102 Ga0307410_10139645 3300031852 Bacteria 1791
103 Ga0307410_10194043 3300031852 Bacteria 1546
104 Ga0307412_10075169 3300031911 Bacteria 2317
105 Ga0307416_100267422 3300032002 Bacteria 1676
106 Ga0307411_10317679 3300032005 Bacteria 1256
107 Ga0316593_10022030 3300032168 Unclassified 1998
108 Ga0316588_1033780 3300033528 Bacteria 1207
109 Ga0373940_0053391 3300035088 Bacteria 1140
110 Ga0373936_0028714 3300035113 Bacteria 2188
111 Ga0316574_0084181 3300035398 Unclassified 2023
112 Ga0316582_0100097 3300036647 Bacteria 1919
113 Ga0400491_01673 3300038727 Bacteria 1811
114 Ga0400483_071674 3300039062 Bacteria 5250
115 Ga0400489_11965 3300039093 Bacteria 1308
116 Ga0400489_57735 3300039093 Bacteria 2528
117 Ga0439436_0042605 3300041404 Bacteria 1297
118 Ga0451789_0836691 3300041443 Bacteria 1075
119 Ga0451793_1511043 3300041452 Bacteria 2437
120 Ga0451797_1477395 3300041453 Bacteria 1877
121 Ga0451795_0815193 3300041456 Bacteria 2402
122 Ga0451798_0271594 3300041458 Bacteria 2570
123 Ga0451802_0219699 3300041460 Bacteria 2129
124 Ga0451807_2757755 3300041486 Bacteria 1489
125 Ga0451853_3089570 3300041512 Bacteria 1570
126 Ga0439437_009613 3300042000 Bacteria 1096
127 Ga0439449_0005193 3300042007 Bacteria 4997
128 Ga0439449_0030315 3300042007 Bacteria 2016
129 Ga0439456_021713 3300042013 Bacteria 1359
130 Ga0450898_021577 3300042134 Bacteria 1135
131 Ga0451577_0089459 3300042876 Bacteria 2747
132 Ga0451577_0525318 3300042876 Bacteria 1075
133 Ga0453683_0006873 3300044673 Bacteria 7762
134 Ga0453683_0048736 3300044673 Bacteria 2657
135 Ga0453684_0008172 3300044712 Bacteria 18880
136 Ga0453684_0042386 3300044712 Bacteria 6136
137 Ga0453684_0137694 3300044712 Bacteria 2920
138 Ga0451576_0002132 3300045051 Bacteria 30697
139 Ga0451576_0369803 3300045051 Bacteria 1502
140 Ga0495638_0014032 3300046460 Bacteria 5430
141 Ga0495610_0077433 3300046512 Bacteria 1536
142 Ga0495628_0103353 3300046516 Bacteria 2197
143 Ga0495632_0009199 3300046519 Bacteria 5972
144 Ga0495587_0088329 3300046536 Bacteria 1793
145 Ga0495599_0103196 3300046678 Bacteria 1777
146 Ga0496126_0458829 3300048929 Bacteria 1024
147 Ga0501298_033062 3300049521 Bacteria 1023
148 Ga0501038_0225648 3300049574 Bacteria 1493
149 Ga0501041_0116514 3300049577 Bacteria 1659
150 Ga0501046_0090876 3300049580 Bacteria 2349
151 Ga0501072_0100324 3300049588 Bacteria 2301
152 Ga0501075_0044422 3300049591 Bacteria 3334
153 Ga0501045_0134253 3300049824 Bacteria 1840
154 nmdc:mga00v17_28689_c1 3300050491 Bacteria 3261
155 nmdc:mga0k408_38699_c1 3300050493 Bacteria 2738
156 nmdc:mga07m45_89960_c1 3300050496 Bacteria 1758
157 nmdc:mga05p37_327019_c1 3300050507 Bacteria 1812
158 nmdc:mga08x19_34550_c1 3300050514 Bacteria 3196
159 nmdc:mga0a205_484135_c1 3300050515 Bacteria 1095
160 Ga0500578_0000064 3300053086 Bacteria 117170
161 Ga0500644_0002579 3300053088 Bacteria 4525
162 Ga0500646_0001717 3300053090 Bacteria 5769
163 Ga0500651_0079013 3300053093 Bacteria 2039
164 Ga0500650_0022905 3300053098 Bacteria 2769
165 Ga0500562_005893 3300053108 Bacteria 3085
166 Ga0500593_000512 3300053117 Bacteria 15217
167 Ga0500628_001863 3300053129 Bacteria 3560
168 Ga0500642_0104377 3300053130 Bacteria 1320
169 Ga0500652_003822 3300053131 Bacteria 4598
170 Ga0500561_0013964 3300053137 Bacteria 1753
171 Ga0500604_0049778 3300053151 Bacteria 1289
172 Ga0500622_0000390 3300053156 Bacteria 42468
173 Ga0500645_000436 3300053730 Bacteria 28554
174 Ga0500645_002908 3300053730 Bacteria 7305
175 Ga0500661_014542 3300055283 Bacteria 1417
176 Ga0590075_003182 3300059424 Bacteria 3906
177 Ga0501082_0096670 3300060353 Bacteria 2553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_484135_c1 nmdc:mga0a205_484135_c1_22_882 286
2 3300042013 Ga0439456_021713 Ga0439456_021713_454_1338 294
3 3300006195 Ga0075366_10061513 Ga0075366_100615132 308
4 3300050493 nmdc:mga0k408_38699_c1 nmdc:mga0k408_38699_c1_539_1546 308
5 3300009147 Ga0114129_10746761 Ga0114129_107467611 309
6 3300048929 Ga0496126_0458829 Ga0496126_0458829_22_981 309
7 3300032005 Ga0307411_10317679 Ga0307411_103176792 312
8 3300044712 Ga0453684_0137694 Ga0453684_0137694_237_1238 313
9 3300028786 Ga0307517_10113154 Ga0307517_101131542 314
10 3300038727 Ga0400491_01673 Ga0400491_01673_627_1574 314
11 3300049574 Ga0501038_0225648 Ga0501038_0225648_263_1249 314
12 3300049577 Ga0501041_0116514 Ga0501041_0116514_106_1092 314
13 3300049580 Ga0501046_0090876 Ga0501046_0090876_610_1596 314
14 3300049588 Ga0501072_0100324 Ga0501072_0100324_713_1699 314
15 3300049591 Ga0501075_0044422 Ga0501075_0044422_257_1243 314
16 3300049824 Ga0501045_0134253 Ga0501045_0134253_168_1154 314
17 3300060353 Ga0501082_0096670 Ga0501082_0096670_1228_2214 314
18 3300002773 JGI25152J39213_1001805 JGI25152J39213_10018058 315
19 3300003215 JGI25153J46596_10003430 JGI25153J46596_100034307 315
20 3300003771 Ga0055526_1002664 Ga0055526_100266410 315
21 3300025245 Ga0207425_1007708 Ga0207425_10077082 315
22 3300025258 Ga0209129_1000212 Ga0209129_10002127 315
23 3300025295 Ga0209564_1000024 Ga0209564_1000024189 315
24 3300025297 Ga0209758_1000558 Ga0209758_100055839 315
25 3300005458 Ga0070681_10000525 Ga0070681_1000052525 316
26 3300025912 Ga0207707_10008578 Ga0207707_100085782 316
27 3300031730 Ga0307516_10012577 Ga0307516_100125771 316
28 3300039093 Ga0400489_57735 Ga0400489_57735_64_1026 317
29 3300042007 Ga0439449_0030315 Ga0439449_0030315_191_1177 317
30 3300053137 Ga0500561_0013964 Ga0500561_0013964_56_1063 317
31 3300035088 Ga0373940_0053391 Ga0373940_0053391_27_1052 318
32 3300042876 Ga0451577_0089459 Ga0451577_0089459_244_1245 319
33 3300044673 Ga0453683_0006873 Ga0453683_0006873_2076_3077 319
34 3300044712 Ga0453684_0042386 Ga0453684_0042386_2148_3149 319
35 3300045051 Ga0451576_0002132 Ga0451576_0002132_10726_11727 319
36 3300031238 Ga0265332_10000005 Ga0265332_10000005300 321
37 3300006914 Ga0075436_100131886 Ga0075436_1001318861 322
38 3300031548 Ga0307408_100161268 Ga0307408_1001612682 322
39 3300049521 Ga0501298_033062 Ga0501298_033062_34_1008 324
40 iso_pu_bacteria 2840878972 2840883443 324
41 iso_pu_bacteria 2894772417 2894773982 325
42 3300027471 Ga0209995_1010451 Ga0209995_10104512 326
43 3300033528 Ga0316588_1033780 Ga0316588_10337801 326
44 3300044673 Ga0453683_0048736 Ga0453683_0048736_365_1351 326
45 3300045051 Ga0451576_0369803 Ga0451576_0369803_44_1030 326
46 3300050507 nmdc:mga05p37_327019_c1 nmdc:mga05p37_327019_c1_556_1536 326
47 3300005444 Ga0070694_100328767 Ga0070694_1003287672 327
48 3300005843 Ga0068860_100000101 Ga0068860_10000010132 327
49 3300035113 Ga0373936_0028714 Ga0373936_0028714_327_1388 327
50 3300035398 Ga0316574_0084181 Ga0316574_0084181_676_1686 327
51 3300039093 Ga0400489_11965 Ga0400489_11965_278_1288 327
52 3300005719 Ga0068861_100029226 Ga0068861_1000292262 328
53 3300005983 Ga0081540_1096869 Ga0081540_10968692 328
54 3300026118 Ga0207675_100353391 Ga0207675_1003533912 328
55 3300041404 Ga0439436_0042605 Ga0439436_0042605_263_1276 328
56 3300042134 Ga0450898_021577 Ga0450898_021577_62_1075 328
57 3300050514 nmdc:mga08x19_34550_c1 nmdc:mga08x19_34550_c1_253_1239 328
58 iso_pu_bacteria 2585428057 2587726073 328
59 iso_pu_bacteria 2588253510 2588290400 328
60 iso_pu_bacteria 2643221592 2643967477 328
61 iso_pu_bacteria 2643221625 2644140300 328
62 iso_pu_bacteria 2643221648 2644271539 328
63 3300005545 Ga0070695_100095000 Ga0070695_1000950003 329
64 3300025295 Ga0209564_1002580 Ga0209564_10025808 329
65 3300031852 Ga0307410_10194043 Ga0307410_101940432 329
66 3300032002 Ga0307416_100267422 Ga0307416_1002674223 329
67 3300039062 Ga0400483_071674 Ga0400483_071674_2130_3128 329
68 3300042000 Ga0439437_009613 Ga0439437_009613_67_1056 329
69 3300005347 Ga0070668_100299205 Ga0070668_1002992051 330
70 3300006058 Ga0075432_10002792 Ga0075432_100027925 330
71 3300025972 Ga0207668_10273056 Ga0207668_102730562 330
72 3300031911 Ga0307412_10075169 Ga0307412_100751692 330
73 3300032168 Ga0316593_10022030 Ga0316593_100220302 330
74 3300036647 Ga0316582_0100097 Ga0316582_0100097_851_1864 330
75 3300046516 Ga0495628_0103353 Ga0495628_0103353_811_1806 331
76 3300046536 Ga0495587_0088329 Ga0495587_0088329_108_1103 331
77 3300046678 Ga0495599_0103196 Ga0495599_0103196_98_1093 331
78 iso_pu_bacteria 2585428058 2587735803 331
79 3300003215 JGI25153J46596_10005507 JGI25153J46596_100055077 332
80 3300003323 rootH1_10032003 rootH1_100320032 332
81 3300003791 Ga0055530_10012263 Ga0055530_100122633 332
82 3300005262 Ga0065165_1011368 Ga0065165_10113683 332
83 3300025273 Ga0209673_1019555 Ga0209673_10195552 332
84 3300025297 Ga0209758_1000248 Ga0209758_1000248107 332
85 3300025298 Ga0209050_1000222 Ga0209050_1000222106 332
86 3300025303 Ga0209051_1046636 Ga0209051_10466362 332
87 3300027671 Ga0209588_1003806 Ga0209588_10038063 332
88 3300041486 Ga0451807_2757755 Ga0451807_2757755_90_1088 332
89 3300042876 Ga0451577_0525318 Ga0451577_0525318_25_1026 332
90 3300046512 Ga0495610_0077433 Ga0495610_0077433_15_1013 332
91 3300053130 Ga0500642_0104377 Ga0500642_0104377_256_1254 332
92 3300041512 Ga0451853_3089570 Ga0451853_3089570_75_1103 333
93 3300053151 Ga0500604_0049778 Ga0500604_0049778_178_1206 333
94 3300006195 Ga0075366_10008861 Ga0075366_100088616 334
95 3300031852 Ga0307410_10139645 Ga0307410_101396452 334
96 3300042007 Ga0439449_0005193 Ga0439449_0005193_3475_4479 334
97 3300044712 Ga0453684_0008172 Ga0453684_0008172_9203_10207 334
98 3300053086 Ga0500578_0000064 Ga0500578_0000064_54768_55775 334
99 3300059424 Ga0590075_003182 Ga0590075_003182_837_1841 334
100 iso_pu_bacteria 2511231002 2511246071 334
101 3300006353 Ga0075370_10027539 Ga0075370_100275392 335
102 3300014968 Ga0157379_10162198 Ga0157379_101621982 335
103 3300031456 Ga0307513_10163722 Ga0307513_101637222 335
104 3300031507 Ga0307509_10087150 Ga0307509_100871503 335
105 3300031730 Ga0307516_10241677 Ga0307516_102416771 335
106 3300041443 Ga0451789_0836691 Ga0451789_0836691_45_1058 335
107 3300041452 Ga0451793_1511043 Ga0451793_1511043_516_1529 335
108 3300041453 Ga0451797_1477395 Ga0451797_1477395_568_1581 335
109 3300041456 Ga0451795_0815193 Ga0451795_0815193_217_1230 335
110 3300041458 Ga0451798_0271594 Ga0451798_0271594_1292_2305 335
111 3300041460 Ga0451802_0219699 Ga0451802_0219699_794_1807 335
112 3300046460 Ga0495638_0014032 Ga0495638_0014032_3109_4122 335
113 3300046519 Ga0495632_0009199 Ga0495632_0009199_1726_2739 335
114 3300050496 nmdc:mga07m45_89960_c1 nmdc:mga07m45_89960_c1_554_1567 335
115 3300053090 Ga0500646_0001717 Ga0500646_0001717_3731_4744 335
116 3300053093 Ga0500651_0079013 Ga0500651_0079013_994_2007 335
117 3300053098 Ga0500650_0022905 Ga0500650_0022905_882_1895 335
118 3300053108 Ga0500562_005893 Ga0500562_005893_144_1157 335
119 3300053129 Ga0500628_001863 Ga0500628_001863_1860_2873 335
120 3300053131 Ga0500652_003822 Ga0500652_003822_917_1930 335
121 3300053156 Ga0500622_0000390 Ga0500622_0000390_31236_32249 335
122 3300025939 Ga0207665_10052467 Ga0207665_100524673 337
123 3300002774 JGI25150J39212_1006670 JGI25150J39212_10066703 338
124 3300002987 JGI25159J45721_1003880 JGI25159J45721_10038805 338
125 3300002987 JGI25159J45721_1004622 JGI25159J45721_10046224 338
126 3300003187 JGI25151J46595_10015908 JGI25151J46595_100159083 338
127 3300003354 JGI25160J50197_1000283 JGI25160J50197_10002833 338
128 3300003354 JGI25160J50197_1000291 JGI25160J50197_10002917 338
129 3300003374 JGI25161J50226_1000015 JGI25161J50226_10000157 338
130 3300003773 Ga0055537_1001270 Ga0055537_10012707 338
131 3300003775 Ga0055524_1000332 Ga0055524_100033240 338
132 3300003784 Ga0055534_1009557 Ga0055534_10095572 338
133 3300003790 Ga0055528_1007574 Ga0055528_10075743 338
134 3300003791 Ga0055530_10004046 Ga0055530_100040466 338
135 3300003792 Ga0055540_1000144 Ga0055540_10001447 338
136 3300003794 Ga0055531_10025858 Ga0055531_100258582 338
137 3300004625 Ga0055543_1000611 Ga0055543_10006116 338
138 3300005262 Ga0065165_1015519 Ga0065165_10155193 338
139 3300005262 Ga0065165_1022847 Ga0065165_10228472 338
140 3300005539 Ga0068853_100130647 Ga0068853_1001306473 338
141 3300006051 Ga0075364_10044463 Ga0075364_100444632 338
142 3300014968 Ga0157379_10057164 Ga0157379_100571642 338
143 3300025245 Ga0207425_1006248 Ga0207425_10062483 338
144 3300025263 Ga0209565_1000004 Ga0209565_1000004152 338
145 3300025273 Ga0209673_1000045 Ga0209673_1000045220 338
146 3300025284 Ga0209130_1000056 Ga0209130_1000056184 338
147 3300025284 Ga0209130_1000413 Ga0209130_100041340 338
148 3300025291 Ga0209675_1000185 Ga0209675_10001853 338
149 3300025292 Ga0209676_1000007 Ga0209676_1000007703 338
150 3300025292 Ga0209676_1005665 Ga0209676_10056652 338
151 3300025294 Ga0209025_1001312 Ga0209025_100131234 338
152 3300025294 Ga0209025_1007845 Ga0209025_10078453 338
153 3300025295 Ga0209564_1004945 Ga0209564_10049456 338
154 3300025297 Ga0209758_1009709 Ga0209758_10097094 338
155 3300025298 Ga0209050_1000003 Ga0209050_1000003805 338
156 3300025298 Ga0209050_1009131 Ga0209050_10091312 338
157 3300025299 Ga0209256_1000001 Ga0209256_1000001816 338
158 3300025299 Ga0209256_1031789 Ga0209256_10317892 338
159 3300025302 Ga0207426_1000025 Ga0207426_1000025138 338
160 3300025303 Ga0209051_1000003 Ga0209051_1000003805 338
161 3300025304 Ga0209257_1000020 Ga0209257_1000020703 338
162 3300026041 Ga0207639_10048168 Ga0207639_100481683 338
163 3300031456 Ga0307513_10000120 Ga0307513_1000012064 338
164 3300050491 nmdc:mga00v17_28689_c1 nmdc:mga00v17_28689_c1_1921_2937 338
165 3300053088 Ga0500644_0002579 Ga0500644_0002579_1736_2752 338
166 3300053117 Ga0500593_000512 Ga0500593_000512_9957_10973 338
167 3300053730 Ga0500645_000436 Ga0500645_000436_22281_23297 338
168 3300053730 Ga0500645_002908 Ga0500645_002908_5058_6074 338
169 3300055283 Ga0500661_014542 Ga0500661_014542_385_1401 338
170 3300005329 Ga0070683_100463885 Ga0070683_1004638851 339
171 3300014325 Ga0163163_10185525 Ga0163163_101855253 339
172 3300031250 Ga0265331_10005217 Ga0265331_100052174 339
173 3300031456 Ga0307513_10159430 Ga0307513_101594302 339
174 3300031595 Ga0265313_10002430 Ga0265313_100024308 339
175 3300031712 Ga0265342_10012949 Ga0265342_100129494 339
176 3300002704 JGI25155J39150_1000343 JGI25155J39150_10003436 340
177 3300002705 JGI25156J39149_1000142 JGI25156J39149_100014246 340
178 3300002738 JGI25154J39366_1000036 JGI25154J39366_10000367 340
179 3300002741 JGI25157J39369_1000023 JGI25157J39369_1000023151 340
180 3300005262 Ga0065165_1016063 Ga0065165_10160632 340
181 3300006946 Ga0079104_1005465 Ga0079104_10054653 340
182 3300025206 Ga0209435_100001 Ga0209435_100001254 340
183 3300025246 Ga0209646_1000001 Ga0209646_1000001623 340
184 3300025250 Ga0209026_1000003 Ga0209026_1000003254 340
185 3300025256 Ga0209759_1000001 Ga0209759_1000001254 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

49

332

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pf6-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans (rd1_0742, target efi-510239) with bound 3-deoxy-d-manno-oct-2-ulosonic acid (kdo) 0.9604 37 340
4pf6-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans (rd1_0742, target efi-510239) with bound 3-deoxy-d-manno-oct-2-ulosonic acid (kdo) 0.9542 37 340
4n6k-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638, target efi-510113 (desal_0342), complex with diglycerolphosphate 0.9401 37 336
7a5q-assembly2.cif.gz_B crystal structure of vcsiap bound to sialic acid 0.9365 38 338
7t3e-assembly2.cif.gz_B structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum 0.9362 37 336
ID Description Score Start End Superfamily
4pf6A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9561 37 340 3.40.190.170
4pf6A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9498 37 340 3.40.190.170
4n6kA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9401 37 336 3.40.190.170
af_P37676_23_328_3.40.190.170 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9359 37 340 3.40.190.170
4pfbA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9336 38 337 3.40.190.170
ID Description Score Start End GO Terms
AF-C9YFV7-F1-model_v4 C4-dicarboxylate ABC transporter 0.9931 34 340 GO:0030288
GO:0055085
AF-A0A439KUF1-F1-model_v4 C4-dicarboxylate ABC transporter 0.9902 37 338 GO:0055085
AF-C9YFV7-F1-model_v4 C4-dicarboxylate ABC transporter 0.9867 34 340 GO:0030288
GO:0055085
AF-A0A439KUF1-F1-model_v4 C4-dicarboxylate ABC transporter 0.9836 37 338 GO:0055085
AF-A0A316NRU8-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9627 36 340 GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
90.72 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map