F284474

General Info

Members Datasets Scaffolds Average Seq Length
185 121 184 115

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10389140|Ga0207661_103891402
Length 135
Sequence VRVSNRTACPAASNGPDLTFHAMQATVTDHRCDIAVLHLRGELDADTAGALRATLVDLLERPVPRIVVDLSDLKFCDSVGLSAFITSKQVITARGGWLSFAGANPFLMRLLETVGLSKYFAIFPEVDDAIAAGQL

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
84 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
100 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
112 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
113 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
114 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
115 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
116 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
117 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
118 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
119 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
121 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 0
Rhizoplane 3.24
Rhizosphere 66.49
Stem 0
Stem Tuber 0
Unclassified 19.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10037614 3300003203 Bacteria 1742
2 JGI25406J46586_10051386 3300003203 Bacteria 1379
3 rootH1_10081205 3300003316 Bacteria 2467
4 rootH1_10107678 3300003316 Bacteria 1027
5 rootL2_10088246 3300003322 Bacteria 6554
6 rootL2_10137263 3300003322 Bacteria 1393
7 Ga0070658_11546163 3300005327 Bacteria 575
8 Ga0070680_101150735 3300005336 Bacteria 671
9 Ga0070682_101290779 3300005337 Bacteria 620
10 Ga0070668_100000673 3300005347 Bacteria 23190
11 Ga0070668_100035484 3300005347 Bacteria 3802
12 Ga0070669_101227476 3300005353 Bacteria 648
13 Ga0070671_100577466 3300005355 Bacteria 971
14 Ga0070667_100026603 3300005367 Bacteria 4812
15 Ga0070667_100850898 3300005367 Bacteria 848
16 Ga0070667_101993059 3300005367 Unclassified 547
17 Ga0070713_101241552 3300005436 Bacteria 722
18 Ga0070710_10384230 3300005437 Bacteria 937
19 Ga0070663_100157670 3300005455 Bacteria 1745
20 Ga0070663_101431898 3300005455 Bacteria 613
21 Ga0070678_100293609 3300005456 Bacteria 1379
22 Ga0070679_100061694 3300005530 Bacteria 3737
23 Ga0070679_100569211 3300005530 Bacteria 1076
24 Ga0068853_100571330 3300005539 Bacteria 1072
25 Ga0070672_100525941 3300005543 Bacteria 1025
26 Ga0070665_100118965 3300005548 Bacteria 2644
27 Ga0070665_101114254 3300005548 Bacteria 801
28 Ga0068852_100848209 3300005616 Bacteria 929
29 Ga0068864_100487869 3300005618 Bacteria 1184
30 Ga0068864_100586427 3300005618 Bacteria 1081
31 Ga0068861_100052778 3300005719 Bacteria 3091
32 Ga0068863_100624338 3300005841 Bacteria 1068
33 Ga0068860_100942744 3300005843 Bacteria 880
34 Ga0081455_10158048 3300005937 Bacteria 1740
35 Ga0081540_1032885 3300005983 Bacteria 2824
36 Ga0081539_10000506 3300005985 Bacteria 81319
37 Ga0081539_10000818 3300005985 Bacteria 60165
38 Ga0081539_10004532 3300005985 Bacteria 15248
39 Ga0081539_10024848 3300005985 Bacteria 3874
40 Ga0081539_10080236 3300005985 Bacteria 1717
41 Ga0081539_10264882 3300005985 Bacteria 756
42 Ga0075428_100211489 3300006844 Bacteria 2096
43 Ga0114129_11055567 3300009147 Bacteria 1020
44 Ga0105243_11744157 3300009148 Bacteria 652
45 Ga0105242_10689972 3300009176 Bacteria 998
46 Ga0105248_10586433 3300009177 Bacteria 1258
47 Ga0105249_12395983 3300009553 Bacteria 600
48 Ga0105246_11131780 3300011119 Bacteria 717
49 Ga0105246_12239695 3300011119 Bacteria 533
50 Ga0157369_10421452 3300013105 Bacteria 1384
51 Ga0157374_10269695 3300013296 Bacteria 1678
52 Ga0157378_11325028 3300013297 Bacteria 761
53 Ga0163162_12377053 3300013306 Bacteria 609
54 Ga0157375_11182217 3300013308 Bacteria 897
55 Ga0157380_11887625 3300014326 Bacteria 658
56 Ga0207692_10329064 3300025898 Bacteria 937
57 Ga0207652_10103280 3300025921 Bacteria 2520
58 Ga0207681_11116076 3300025923 Bacteria 662
59 Ga0207650_10371873 3300025925 Bacteria 1179
60 Ga0207700_10400546 3300025928 Bacteria 1203
61 Ga0207661_10389140 3300025944 Bacteria 1263
62 Ga0207679_11895977 3300025945 Bacteria 544
63 Ga0207712_11141887 3300025961 Bacteria 694
64 Ga0207668_10032055 3300025972 Bacteria 3469
65 Ga0207668_10065412 3300025972 Bacteria 2573
66 Ga0207658_10231849 3300025986 Bacteria 1559
67 Ga0207658_11869753 3300025986 Unclassified 547
68 Ga0207677_11906605 3300026023 Bacteria 552
69 Ga0207639_10764126 3300026041 Bacteria 899
70 Ga0207678_10461453 3300026067 Bacteria 1105
71 Ga0207641_10119238 3300026088 Bacteria 2352
72 Ga0207676_10229410 3300026095 Bacteria 1659
73 Ga0207675_100605117 3300026118 Bacteria 1099
74 Ga0207698_11962432 3300026142 Bacteria 600
75 Ga0268266_12169670 3300028379 Bacteria 528
76 Ga0268265_10238661 3300028380 Bacteria 1602
77 Ga0268264_10035478 3300028381 Bacteria 4106
78 Ga0307517_10107136 3300028786 Bacteria 2156
79 Ga0307517_10156416 3300028786 Bacteria 1545
80 Ga0307517_10527678 3300028786 Bacteria 595
81 Ga0307515_10000083 3300028794 Bacteria 222889
82 Ga0307515_10010352 3300028794 Bacteria 17872
83 Ga0307515_10065637 3300028794 Bacteria 5045
84 Ga0307515_10130544 3300028794 Bacteria 2771
85 Ga0307512_10018678 3300030522 Bacteria 6330
86 Ga0307512_10031735 3300030522 Bacteria 4570
87 Ga0307513_10018604 3300031456 Bacteria 8296
88 Ga0307513_10033676 3300031456 Bacteria 5756
89 Ga0307513_10926266 3300031456 Bacteria 579
90 Ga0307509_10192286 3300031507 Bacteria 1890
91 Ga0307509_10252746 3300031507 Bacteria 1545
92 Ga0307509_10595995 3300031507 Bacteria 778
93 Ga0307509_10684028 3300031507 Bacteria 693
94 Ga0307408_100351842 3300031548 Bacteria 1250
95 Ga0307408_101005673 3300031548 Bacteria 769
96 Ga0307508_10001926 3300031616 Bacteria 22770
97 Ga0307508_10050418 3300031616 Bacteria 3705
98 Ga0307508_10306041 3300031616 Bacteria 1182
99 Ga0307508_10402343 3300031616 Bacteria 960
100 Ga0307516_10005597 3300031730 Bacteria 14961
101 Ga0307516_10036774 3300031730 Bacteria 4898
102 Ga0307516_10091788 3300031730 Bacteria 2864
103 Ga0307516_10726319 3300031730 Bacteria 651
104 Ga0307405_10182590 3300031731 Bacteria 1508
105 Ga0307405_10973134 3300031731 Bacteria 722
106 Ga0307413_10021553 3300031824 Bacteria 3454
107 Ga0307413_10237058 3300031824 Bacteria 1344
108 Ga0307410_10070256 3300031852 Bacteria 2425
109 Ga0307410_10213862 3300031852 Bacteria 1479
110 Ga0307410_10945665 3300031852 Bacteria 740
111 Ga0326468_10000707 3300031889 Bacteria 3376
112 Ga0307406_10336822 3300031901 Bacteria 1173
113 Ga0307407_10654419 3300031903 Bacteria 787
114 Ga0307407_10789527 3300031903 Bacteria 722
115 Ga0307407_10790662 3300031903 Bacteria 721
116 Ga0307407_10839517 3300031903 Bacteria 701
117 Ga0307412_10487825 3300031911 Bacteria 1023
118 Ga0307412_10702427 3300031911 Bacteria 868
119 Ga0307409_100019141 3300031995 Bacteria 4626
120 Ga0307409_100275418 3300031995 Bacteria 1552
121 Ga0307409_101590320 3300031995 Bacteria 682
122 Ga0307409_101880470 3300031995 Bacteria 628
123 Ga0307409_101898219 3300031995 Bacteria 625
124 Ga0307409_102490148 3300031995 Bacteria 546
125 Ga0307409_102938804 3300031995 Bacteria 503
126 Ga0307416_100064915 3300032002 Bacteria 2997
127 Ga0307416_100421837 3300032002 Bacteria 1379
128 Ga0307416_100660157 3300032002 Bacteria 1131
129 Ga0307416_101289420 3300032002 Bacteria 836
130 Ga0307414_10873514 3300032004 Bacteria 823
131 Ga0307411_10179683 3300032005 Bacteria 1605
132 Ga0307411_11025631 3300032005 Bacteria 740
133 Ga0307415_100133909 3300032126 Bacteria 1881
134 Ga0307415_100154157 3300032126 Bacteria 1772
135 Ga0307415_100338682 3300032126 Bacteria 1261
136 Ga0307415_100448765 3300032126 Bacteria 1114
137 Ga0307415_101841276 3300032126 Bacteria 586
138 Ga0307507_10087706 3300033179 Bacteria 2689
139 Ga0307510_10353519 3300033180 Bacteria 919
140 Ga0307510_10359733 3300033180 Bacteria 904
141 Ga0373940_0012289 3300035088 Bacteria 2049
142 Ga0373951_0000139 3300035091 Bacteria 27302
143 Ga0373939_0537244 3300035114 Bacteria 504
144 Ga0373942_0000812 3300035207 Bacteria 8602
145 Ga0373961_0351366 3300035241 Bacteria 556
146 Ga0373962_0005932 3300035242 Bacteria 2949
147 Ga0373935_0072772 3300035692 Bacteria 2220
148 Ga0373925_0672108 3300037068 Bacteria 854
149 Ga0451791_0391476 3300041451 Bacteria 540
150 Ga0451791_0628866 3300041451 Bacteria 2882
151 Ga0451797_0572089 3300041453 Bacteria 1271
152 Ga0451795_0499896 3300041456 Bacteria 1327
153 Ga0451807_2263486 3300041486 Bacteria 514
154 Ga0451833_1245935 3300041491 Bacteria 576
155 Ga0451837_0362988 3300041494 Bacteria 1093
156 Ga0451837_0403991 3300041494 Bacteria 626
157 Ga0451851_0505734 3300041507 Bacteria 550
158 Ga0451853_2213945 3300041512 Bacteria 3023
159 Ga0439455_0210545 3300042012 Unclassified 564
160 Ga0439459_0062428 3300042438 Bacteria 845
161 Ga0466970_0728151 3300044765 Bacteria 579
162 Ga0495632_0083589 3300046519 Bacteria 1520
163 Ga0496108_0000071 3300048911 Bacteria 113930
164 nmdc:mga05p37_930385_c1 3300050507 Bacteria 933
165 Ga0500644_0486555 3300053088 Bacteria 542
166 Ga0500646_0032127 3300053090 Bacteria 1447
167 Ga0500646_0132547 3300053090 Bacteria 811
168 Ga0500583_0371808 3300053092 Bacteria 690
169 Ga0500651_0074504 3300053093 Bacteria 2109
170 Ga0500641_0038154 3300053096 Bacteria 1929
171 Ga0500641_0369783 3300053096 Bacteria 571
172 Ga0500650_0143960 3300053098 Bacteria 1104
173 Ga0500562_092366 3300053108 Bacteria 822
174 Ga0500569_007374 3300053109 Bacteria 2465
175 Ga0500594_0023454 3300053118 Bacteria 1564
176 Ga0500594_0194424 3300053118 Bacteria 665
177 Ga0500621_082539 3300053126 Bacteria 1287
178 Ga0500652_004025 3300053131 Bacteria 4506
179 Ga0500658_0340225 3300053134 Bacteria 689
180 Ga0500577_0138534 3300053142 Bacteria 1025
181 Ga0500579_032791 3300053143 Bacteria 3324
182 Ga0500600_0111151 3300053149 Bacteria 1428
183 Ga0500622_0135332 3300053156 Bacteria 1181
184 Ga0500633_0163094 3300053160 Bacteria 836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2751185782 2753266876 109
2 3300031548 Ga0307408_101005673 Ga0307408_1010056732 110
3 3300031730 Ga0307516_10036774 Ga0307516_100367747 111
4 3300003203 JGI25406J46586_10037614 JGI25406J46586_100376143 113
5 3300003203 JGI25406J46586_10051386 JGI25406J46586_100513862 113
6 3300003316 rootH1_10081205 rootH1_100812051 113
7 3300003316 rootH1_10107678 rootH1_101076782 113
8 3300003322 rootL2_10088246 rootL2_100882461 113
9 3300003322 rootL2_10137263 rootL2_101372633 113
10 3300005327 Ga0070658_11546163 Ga0070658_115461632 113
11 3300005336 Ga0070680_101150735 Ga0070680_1011507351 113
12 3300005337 Ga0070682_101290779 Ga0070682_1012907791 113
13 3300005347 Ga0070668_100000673 Ga0070668_10000067322 113
14 3300005347 Ga0070668_100035484 Ga0070668_1000354845 113
15 3300005353 Ga0070669_101227476 Ga0070669_1012274761 113
16 3300005355 Ga0070671_100577466 Ga0070671_1005774662 113
17 3300005367 Ga0070667_100026603 Ga0070667_1000266035 113
18 3300005367 Ga0070667_100850898 Ga0070667_1008508982 113
19 3300005367 Ga0070667_101993059 Ga0070667_1019930591 113
20 3300005436 Ga0070713_101241552 Ga0070713_1012415521 113
21 3300005437 Ga0070710_10384230 Ga0070710_103842302 113
22 3300005455 Ga0070663_100157670 Ga0070663_1001576703 113
23 3300005455 Ga0070663_101431898 Ga0070663_1014318982 113
24 3300005456 Ga0070678_100293609 Ga0070678_1002936092 113
25 3300005530 Ga0070679_100061694 Ga0070679_1000616944 113
26 3300005530 Ga0070679_100569211 Ga0070679_1005692112 113
27 3300005539 Ga0068853_100571330 Ga0068853_1005713302 113
28 3300005543 Ga0070672_100525941 Ga0070672_1005259412 113
29 3300005548 Ga0070665_100118965 Ga0070665_1001189652 113
30 3300005548 Ga0070665_101114254 Ga0070665_1011142541 113
31 3300005616 Ga0068852_100848209 Ga0068852_1008482091 113
32 3300005618 Ga0068864_100487869 Ga0068864_1004878692 113
33 3300005618 Ga0068864_100586427 Ga0068864_1005864272 113
34 3300005719 Ga0068861_100052778 Ga0068861_1000527782 113
35 3300005841 Ga0068863_100624338 Ga0068863_1006243382 113
36 3300005843 Ga0068860_100942744 Ga0068860_1009427442 113
37 3300005937 Ga0081455_10158048 Ga0081455_101580482 113
38 3300005983 Ga0081540_1032885 Ga0081540_10328853 113
39 3300005985 Ga0081539_10000506 Ga0081539_1000050640 113
40 3300005985 Ga0081539_10000818 Ga0081539_1000081833 113
41 3300005985 Ga0081539_10004532 Ga0081539_1000453211 113
42 3300005985 Ga0081539_10024848 Ga0081539_100248485 113
43 3300005985 Ga0081539_10080236 Ga0081539_100802364 113
44 3300005985 Ga0081539_10264882 Ga0081539_102648822 113
45 3300006844 Ga0075428_100211489 Ga0075428_1002114891 113
46 3300009147 Ga0114129_11055567 Ga0114129_110555671 113
47 3300009148 Ga0105243_11744157 Ga0105243_117441571 113
48 3300009176 Ga0105242_10689972 Ga0105242_106899721 113
49 3300009177 Ga0105248_10586433 Ga0105248_105864332 113
50 3300009553 Ga0105249_12395983 Ga0105249_123959832 113
51 3300011119 Ga0105246_11131780 Ga0105246_111317801 113
52 3300011119 Ga0105246_12239695 Ga0105246_122396951 113
53 3300013105 Ga0157369_10421452 Ga0157369_104214523 113
54 3300013296 Ga0157374_10269695 Ga0157374_102696953 113
55 3300013297 Ga0157378_11325028 Ga0157378_113250282 113
56 3300013306 Ga0163162_12377053 Ga0163162_123770531 113
57 3300013308 Ga0157375_11182217 Ga0157375_111822171 113
58 3300014326 Ga0157380_11887625 Ga0157380_118876251 113
59 3300025898 Ga0207692_10329064 Ga0207692_103290642 113
60 3300025921 Ga0207652_10103280 Ga0207652_101032801 113
61 3300025923 Ga0207681_11116076 Ga0207681_111160761 113
62 3300025925 Ga0207650_10371873 Ga0207650_103718732 113
63 3300025928 Ga0207700_10400546 Ga0207700_104005461 113
64 3300025944 Ga0207661_10389140 Ga0207661_103891402 113
65 3300025945 Ga0207679_11895977 Ga0207679_118959771 113
66 3300025961 Ga0207712_11141887 Ga0207712_111418871 113
67 3300025972 Ga0207668_10032055 Ga0207668_100320556 113
68 3300025972 Ga0207668_10065412 Ga0207668_100654122 113
69 3300025986 Ga0207658_10231849 Ga0207658_102318493 113
70 3300025986 Ga0207658_11869753 Ga0207658_118697531 113
71 3300026023 Ga0207677_11906605 Ga0207677_119066051 113
72 3300026041 Ga0207639_10764126 Ga0207639_107641262 113
73 3300026067 Ga0207678_10461453 Ga0207678_104614532 113
74 3300026088 Ga0207641_10119238 Ga0207641_101192383 113
75 3300026095 Ga0207676_10229410 Ga0207676_102294103 113
76 3300026118 Ga0207675_100605117 Ga0207675_1006051172 113
77 3300026142 Ga0207698_11962432 Ga0207698_119624321 113
78 3300028379 Ga0268266_12169670 Ga0268266_121696702 113
79 3300028380 Ga0268265_10238661 Ga0268265_102386614 113
80 3300028381 Ga0268264_10035478 Ga0268264_100354783 113
81 3300028786 Ga0307517_10107136 Ga0307517_101071361 113
82 3300028786 Ga0307517_10156416 Ga0307517_101564162 113
83 3300028786 Ga0307517_10527678 Ga0307517_105276781 113
84 3300028794 Ga0307515_10000083 Ga0307515_1000008392 113
85 3300028794 Ga0307515_10010352 Ga0307515_1001035214 113
86 3300028794 Ga0307515_10065637 Ga0307515_100656371 113
87 3300028794 Ga0307515_10130544 Ga0307515_101305441 113
88 3300030522 Ga0307512_10018678 Ga0307512_100186788 113
89 3300030522 Ga0307512_10031735 Ga0307512_100317355 113
90 3300031456 Ga0307513_10018604 Ga0307513_100186042 113
91 3300031456 Ga0307513_10033676 Ga0307513_100336764 113
92 3300031456 Ga0307513_10926266 Ga0307513_109262662 113
93 3300031507 Ga0307509_10192286 Ga0307509_101922863 113
94 3300031507 Ga0307509_10252746 Ga0307509_102527463 113
95 3300031507 Ga0307509_10595995 Ga0307509_105959951 113
96 3300031507 Ga0307509_10684028 Ga0307509_106840281 113
97 3300031548 Ga0307408_100351842 Ga0307408_1003518421 113
98 3300031616 Ga0307508_10001926 Ga0307508_100019263 113
99 3300031616 Ga0307508_10050418 Ga0307508_100504183 113
100 3300031616 Ga0307508_10306041 Ga0307508_103060412 113
101 3300031616 Ga0307508_10402343 Ga0307508_104023432 113
102 3300031730 Ga0307516_10005597 Ga0307516_1000559711 113
103 3300031730 Ga0307516_10091788 Ga0307516_100917883 113
104 3300031730 Ga0307516_10726319 Ga0307516_107263192 113
105 3300031731 Ga0307405_10182590 Ga0307405_101825903 113
106 3300031731 Ga0307405_10973134 Ga0307405_109731341 113
107 3300031824 Ga0307413_10021553 Ga0307413_100215535 113
108 3300031824 Ga0307413_10237058 Ga0307413_102370581 113
109 3300031852 Ga0307410_10070256 Ga0307410_100702562 113
110 3300031852 Ga0307410_10213862 Ga0307410_102138622 113
111 3300031852 Ga0307410_10945665 Ga0307410_109456651 113
112 3300031889 Ga0326468_10000707 Ga0326468_100007074 113
113 3300031901 Ga0307406_10336822 Ga0307406_103368222 113
114 3300031903 Ga0307407_10654419 Ga0307407_106544192 113
115 3300031903 Ga0307407_10789527 Ga0307407_107895272 113
116 3300031903 Ga0307407_10790662 Ga0307407_107906622 113
117 3300031903 Ga0307407_10839517 Ga0307407_108395172 113
118 3300031911 Ga0307412_10487825 Ga0307412_104878252 113
119 3300031911 Ga0307412_10702427 Ga0307412_107024273 113
120 3300031995 Ga0307409_100019141 Ga0307409_1000191415 113
121 3300031995 Ga0307409_100275418 Ga0307409_1002754182 113
122 3300031995 Ga0307409_101590320 Ga0307409_1015903202 113
123 3300031995 Ga0307409_101880470 Ga0307409_1018804701 113
124 3300031995 Ga0307409_101898219 Ga0307409_1018982191 113
125 3300031995 Ga0307409_102490148 Ga0307409_1024901481 113
126 3300031995 Ga0307409_102938804 Ga0307409_1029388041 113
127 3300032002 Ga0307416_100064915 Ga0307416_1000649153 113
128 3300032002 Ga0307416_100421837 Ga0307416_1004218372 113
129 3300032002 Ga0307416_100660157 Ga0307416_1006601572 113
130 3300032002 Ga0307416_101289420 Ga0307416_1012894201 113
131 3300032004 Ga0307414_10873514 Ga0307414_108735142 113
132 3300032005 Ga0307411_10179683 Ga0307411_101796831 113
133 3300032005 Ga0307411_11025631 Ga0307411_110256311 113
134 3300032126 Ga0307415_100133909 Ga0307415_1001339092 113
135 3300032126 Ga0307415_100154157 Ga0307415_1001541572 113
136 3300032126 Ga0307415_100338682 Ga0307415_1003386822 113
137 3300032126 Ga0307415_100448765 Ga0307415_1004487652 113
138 3300032126 Ga0307415_101841276 Ga0307415_1018412762 113
139 3300033179 Ga0307507_10087706 Ga0307507_100877061 113
140 3300033180 Ga0307510_10353519 Ga0307510_103535191 113
141 3300033180 Ga0307510_10359733 Ga0307510_103597332 113
142 3300035088 Ga0373940_0012289 Ga0373940_0012289_145_486 113
143 3300035091 Ga0373951_0000139 Ga0373951_0000139_11106_11447 113
144 3300035114 Ga0373939_0537244 Ga0373939_0537244_55_396 113
145 3300035207 Ga0373942_0000812 Ga0373942_0000812_4538_4879 113
146 3300035241 Ga0373961_0351366 Ga0373961_0351366_189_530 113
147 3300035242 Ga0373962_0005932 Ga0373962_0005932_908_1249 113
148 3300035692 Ga0373935_0072772 Ga0373935_0072772_1823_2164 113
149 3300037068 Ga0373925_0672108 Ga0373925_0672108_502_843 113
150 3300041451 Ga0451791_0391476 Ga0451791_0391476_186_527 113
151 3300041451 Ga0451791_0628866 Ga0451791_0628866_1067_1408 113
152 3300041453 Ga0451797_0572089 Ga0451797_0572089_213_554 113
153 3300041456 Ga0451795_0499896 Ga0451795_0499896_615_956 113
154 3300041486 Ga0451807_2263486 Ga0451807_2263486_86_427 113
155 3300041491 Ga0451833_1245935 Ga0451833_1245935_71_412 113
156 3300041494 Ga0451837_0362988 Ga0451837_0362988_334_675 113
157 3300041494 Ga0451837_0403991 Ga0451837_0403991_199_540 113
158 3300041507 Ga0451851_0505734 Ga0451851_0505734_77_418 113
159 3300041512 Ga0451853_2213945 Ga0451853_2213945_1827_2168 113
160 3300042012 Ga0439455_0210545 Ga0439455_0210545_28_369 113
161 3300042438 Ga0439459_0062428 Ga0439459_0062428_475_816 113
162 3300044765 Ga0466970_0728151 Ga0466970_0728151_73_414 113
163 3300046519 Ga0495632_0083589 Ga0495632_0083589_847_1188 113
164 3300048911 Ga0496108_0000071 Ga0496108_0000071_70978_71319 113
165 3300050507 nmdc:mga05p37_930385_c1 nmdc:mga05p37_930385_c1_71_436 113
166 3300053088 Ga0500644_0486555 Ga0500644_0486555_177_518 113
167 3300053090 Ga0500646_0032127 Ga0500646_0032127_971_1312 113
168 3300053090 Ga0500646_0132547 Ga0500646_0132547_343_684 113
169 3300053092 Ga0500583_0371808 Ga0500583_0371808_271_612 113
170 3300053093 Ga0500651_0074504 Ga0500651_0074504_783_1124 113
171 3300053096 Ga0500641_0038154 Ga0500641_0038154_1352_1693 113
172 3300053096 Ga0500641_0369783 Ga0500641_0369783_134_475 113
173 3300053098 Ga0500650_0143960 Ga0500650_0143960_739_1080 113
174 3300053108 Ga0500562_092366 Ga0500562_092366_273_614 113
175 3300053109 Ga0500569_007374 Ga0500569_007374_554_895 113
176 3300053118 Ga0500594_0023454 Ga0500594_0023454_206_547 113
177 3300053118 Ga0500594_0194424 Ga0500594_0194424_104_445 113
178 3300053126 Ga0500621_082539 Ga0500621_082539_738_1079 113
179 3300053131 Ga0500652_004025 Ga0500652_004025_274_615 113
180 3300053134 Ga0500658_0340225 Ga0500658_0340225_332_673 113
181 3300053142 Ga0500577_0138534 Ga0500577_0138534_29_370 113
182 3300053143 Ga0500579_032791 Ga0500579_032791_960_1301 113
183 3300053149 Ga0500600_0111151 Ga0500600_0111151_18_359 113
184 3300053156 Ga0500622_0135332 Ga0500622_0135332_740_1081 113
185 3300053160 Ga0500633_0163094 Ga0500633_0163094_388_729 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13466

STAS_2

STAS domain

37

117

0.97

PF01740

STAS

STAS domain

25

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9446 2 98
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9346 2 101
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.9278 2 106
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9185 2 113
1sbo-assembly1.cif.gz_A solution structure of putative anti sigma factor antagonist from thermotoga maritima (tm1442) 0.9101 2 106
ID Description Score Start End Superfamily
af_I1KV89_512_657_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9172 12 110 3.30.750.24
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9145 2 112 3.30.750.24
af_G5EC30_461_581_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9142 10 91 3.30.750.24
af_Q55FJ8_836_995_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9133 7 113 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9109 2 113 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A847DAB7-F1-model_v4 Anti-sigma factor antagonist 0.979 1 109 GO:0043856
AF-A0A800MHJ9-F1-model_v4 Anti-sigma factor antagonist 0.9762 2 112 GO:0043856
AF-A0A1F5YEF8-F1-model_v4 Anti-sigma factor antagonist 0.9761 1 112 GO:0043856
AF-A0A7K3NRJ7-F1-model_v4 Anti-sigma factor antagonist 0.9756 1 110 GO:0043856
AF-A0A2V2BYV9-F1-model_v4 Anti-sigma factor antagonist 0.9756 1 110 GO:0043856

Feature Viewer

pLDDT pTM Quality
86.77 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map