F284463

General Info

Members Datasets Scaffolds Average Seq Length
185 86 368 153

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10283007|Ga0207709_102830071
Length 161
Sequence MTPQGLLFRPATRTDLPVIVRMLADDELGSQRERVENPLPASYYSAFEQIESDPNHELVVAELNGEVIGTLHLMFLPSVSFQGGLRAQVESVRVDKRFQSQGIGSEMMKWAMERARQRSAHVVQLTTHKSRVDAHRFYERLGFVMIEDLGAYKHMEWKAES

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
62 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
63 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
78 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
86 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 0.54
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 19.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10283007 3300025935 Bacteria 1225
2 SwRhRL2b_contig_3164769 2162886007 Bacteria 2680
3 MBSR1b_contig_10856210 2162886012 Bacteria 1286
4 MBSR1b_contig_2945480 2162886012 Bacteria 1560
5 Ga0065704_10185673 3300005289 Bacteria 1214
6 Ga0065707_10023055 3300005295 Bacteria 1329
7 Ga0065707_10082075 3300005295 Bacteria 22566
8 Ga0065707_10114173 3300005295 Bacteria 2305
9 Ga0065707_10163700 3300005295 Unclassified 1541
10 Ga0070689_100114888 3300005340 Bacteria 2145
11 Ga0070691_10531826 3300005341 Unclassified 684
12 Ga0070692_10283999 3300005345 Bacteria 1004
13 Ga0070667_100233903 3300005367 Bacteria 1639
14 Ga0070700_100282635 3300005441 Bacteria 1204
15 Ga0070694_100034697 3300005444 Bacteria 3329
16 Ga0070694_100150984 3300005444 Bacteria 1697
17 Ga0070694_101415715 3300005444 Bacteria 587
18 Ga0070706_101156236 3300005467 Unclassified 712
19 Ga0070707_100294944 3300005468 Bacteria 1575
20 Ga0070707_100816306 3300005468 Bacteria 896
21 Ga0070698_100016976 3300005471 Bacteria 7674
22 Ga0070698_100084512 3300005471 Bacteria 3162
23 Ga0070698_100130506 3300005471 Unclassified 2468
24 Ga0070698_100373335 3300005471 Bacteria 1358
25 Ga0070698_100482649 3300005471 Bacteria 1176
26 Ga0070699_100158068 3300005518 Bacteria 2006
27 Ga0070695_100243125 3300005545 Bacteria 1306
28 Ga0070695_100821621 3300005545 Unclassified 746
29 Ga0070696_100069086 3300005546 Bacteria 2481
30 Ga0070696_101796776 3300005546 Unclassified 530
31 Ga0068859_100520431 3300005617 Bacteria 1285
32 Ga0068859_101916094 3300005617 Bacteria 654
33 Ga0068864_100024066 3300005618 Bacteria 5119
34 Ga0068870_10361464 3300005840 Bacteria 934
35 Ga0068863_100033380 3300005841 Bacteria 4903
36 Ga0068862_100002570 3300005844 Bacteria 16031
37 Ga0068862_100158385 3300005844 Bacteria 2020
38 Ga0068862_101106271 3300005844 Bacteria 788
39 Ga0068862_101307022 3300005844 Bacteria 727
40 Ga0075363_100024648 3300006048 Unclassified 3060
41 Ga0070712_100308397 3300006175 Bacteria 1283
42 Ga0075427_10001933 3300006194 Bacteria 2726
43 Ga0075428_100125451 3300006844 Bacteria 2793
44 Ga0075428_100132972 3300006844 Bacteria 2705
45 Ga0075428_100316399 3300006844 Bacteria 1677
46 Ga0075428_100372722 3300006844 Bacteria 1531
47 Ga0075428_100828464 3300006844 Unclassified 983
48 Ga0075428_102302019 3300006844 Unclassified 554
49 Ga0075430_100184564 3300006846 Bacteria 1734
50 Ga0075430_100400012 3300006846 Bacteria 1134
51 Ga0075431_100091698 3300006847 Bacteria 3135
52 Ga0075431_100511817 3300006847 Bacteria 1190
53 Ga0075433_10235639 3300006852 Bacteria 1625
54 Ga0075434_100356094 3300006871 Bacteria 1484
55 Ga0075434_100360162 3300006871 Bacteria 1475
56 Ga0075429_100008873 3300006880 Bacteria 8739
57 Ga0075429_100101888 3300006880 Bacteria 2506
58 Ga0075429_100135236 3300006880 Bacteria 2157
59 Ga0075429_100255366 3300006880 Bacteria 1535
60 Ga0075429_100355054 3300006880 Bacteria 1283
61 Ga0075429_100470419 3300006880 Unclassified 1101
62 Ga0097620_100520427 3300006931 Bacteria 1285
63 Ga0097620_101916057 3300006931 Bacteria 654
64 Ga0105240_10435209 3300009093 Bacteria 1471
65 Ga0111539_10052949 3300009094 Bacteria 4831
66 Ga0111539_12702821 3300009094 Bacteria 575
67 Ga0105245_11453385 3300009098 Unclassified 736
68 Ga0114129_10001019 3300009147 Bacteria 36579
69 Ga0114129_10024459 3300009147 Bacteria 8557
70 Ga0114129_10040857 3300009147 Bacteria 6538
71 Ga0114129_10092946 3300009147 Bacteria 4179
72 Ga0114129_10249386 3300009147 Bacteria 2384
73 Ga0114129_10449129 3300009147 Bacteria 1691
74 Ga0114129_10464677 3300009147 Bacteria 1658
75 Ga0114129_10830480 3300009147 Bacteria 1176
76 Ga0105243_10019237 3300009148 Bacteria 5178
77 Ga0105243_10215278 3300009148 Bacteria 1694
78 Ga0105249_10026853 3300009553 Bacteria 5192
79 Ga0105249_10204245 3300009553 Bacteria 1935
80 Ga0105249_10569260 3300009553 Bacteria 1185
81 Ga0105249_10755668 3300009553 Bacteria 1034
82 Ga0105249_10812951 3300009553 Bacteria 999
83 Ga0105246_10116545 3300011119 Bacteria 1972
84 Ga0105246_10241681 3300011119 Bacteria 1428
85 Ga0163162_10811516 3300013306 Unclassified 1052
86 Ga0157380_10926208 3300014326 Unclassified 899
87 Ga0207684_10083349 3300025910 Bacteria 2723
88 Ga0207660_10300835 3300025917 Bacteria 1277
89 Ga0207646_10390535 3300025922 Bacteria 1257
90 Ga0207646_10500408 3300025922 Bacteria 1095
91 Ga0207709_10010151 3300025935 Bacteria 5186
92 Ga0207709_10050485 3300025935 Bacteria 2544
93 Ga0207712_10112442 3300025961 Bacteria 2045
94 Ga0207703_10423456 3300026035 Bacteria 1239
95 Ga0207708_10254853 3300026075 Bacteria 1415
96 Ga0207676_10027121 3300026095 Bacteria 4264
97 Ga0207674_10163477 3300026116 Bacteria 2180
98 Ga0207675_100131750 3300026118 Bacteria 2371
99 Ga0268265_10025079 3300028380 Bacteria 4227
100 Ga0268265_11496798 3300028380 Bacteria 678
101 Ga0265338_10405188 3300028800 Unclassified 972
102 Ga0265340_10024278 3300031247 Bacteria 3081
103 Ga0265314_10241125 3300031711 Bacteria 1043
104 Ga0265342_10209508 3300031712 Bacteria 1055
105 Ga0307410_10470389 3300031852 Bacteria 1029
106 Ga0307410_11091945 3300031852 Unclassified 691
107 Ga0307406_11230922 3300031901 Unclassified 651
108 Ga0307407_10055417 3300031903 Bacteria 2291
109 Ga0307409_101514930 3300031995 Unclassified 698
110 Ga0307416_100624914 3300032002 Bacteria 1159
111 Ga0451800_0149939 3300041459 Bacteria 1207
112 Ga0439445_0009587 3300042004 Bacteria 2284
113 Ga0439446_0030516 3300042156 Bacteria 1558
114 Ga0451577_0352060 3300042876 Bacteria 1336
115 Ga0451577_0708296 3300042876 Bacteria 912
116 Ga0451577_0721054 3300042876 Unclassified 903
117 Ga0451577_0876011 3300042876 Bacteria 809
118 Ga0451577_0913007 3300042876 Unclassified 790
119 Ga0453683_0006138 3300044673 Bacteria 8274
120 Ga0453683_0032263 3300044673 Bacteria 3306
121 Ga0453683_0060929 3300044673 Bacteria 2359
122 Ga0453683_0096486 3300044673 Bacteria 1855
123 Ga0453683_0113060 3300044673 Bacteria 1708
124 Ga0453683_0135710 3300044673 Unclassified 1552
125 Ga0453684_0007622 3300044712 Bacteria 19828
126 Ga0453684_0043141 3300044712 Bacteria 6068
127 Ga0453684_0155907 3300044712 Bacteria 2708
128 Ga0453684_0247811 3300044712 Unclassified 2047
129 Ga0453684_0388537 3300044712 Bacteria 1565
130 Ga0453684_0412398 3300044712 Bacteria 1510
131 Ga0453684_0416826 3300044712 Bacteria 1501
132 Ga0453684_0519672 3300044712 Bacteria 1315
133 Ga0453684_0570067 3300044712 Bacteria 1244
134 Ga0453684_0654223 3300044712 Bacteria 1146
135 Ga0453684_0852608 3300044712 Bacteria 979
136 Ga0453684_1037660 3300044712 Bacteria 870
137 Ga0453684_2104625 3300044712 Bacteria 566
138 Ga0453684_2340866 3300044712 Unclassified 530
139 Ga0451576_0000263 3300045051 Bacteria 128339
140 Ga0451576_0007007 3300045051 Bacteria 13637
141 Ga0451576_0059241 3300045051 Bacteria 3998
142 Ga0451576_0076396 3300045051 Bacteria 3485
143 Ga0451576_0083357 3300045051 Unclassified 3326
144 Ga0451576_0124968 3300045051 Bacteria 2680
145 Ga0451576_0588157 3300045051 Bacteria 1170
146 Ga0451576_0809602 3300045051 Unclassified 984
147 Ga0501031_0557639 3300049568 Bacteria 738
148 Ga0501041_0111368 3300049577 Bacteria 1698
149 Ga0501068_0135690 3300049584 Bacteria 1541
150 Ga0501071_0634545 3300049587 Bacteria 822
151 Ga0501072_0392732 3300049588 Bacteria 1101
152 Ga0501072_0436834 3300049588 Bacteria 1037
153 Ga0501075_0874386 3300049591 Bacteria 683
154 Ga0501076_0234953 3300049592 Unclassified 1499
155 Ga0501080_1445555 3300049742 Unclassified 586
156 Ga0501045_0353826 3300049824 Bacteria 1093
157 nmdc:mga03n38_28780_c2 3300050490 Unclassified 696
158 nmdc:mga06z11_62722_c1 3300050494 Bacteria 1942
159 nmdc:mga05p37_114589_c1 3300050507 Bacteria 3314
160 nmdc:mga05p37_4091_c1 3300050507 Bacteria 17040
161 nmdc:mga05p37_463853_c1 3300050507 Bacteria 1463
162 nmdc:mga05p37_488842_c1 3300050507 Bacteria 1416
163 nmdc:mga05p37_607119_c1 3300050507 Unclassified 1234
164 nmdc:mga09592_132284_c1 3300050508 Bacteria 2147
165 nmdc:mga09592_1347607_c1 3300050508 Unclassified 585
166 nmdc:mga09592_13750_c1 3300050508 Bacteria 6612
167 nmdc:mga09592_1576920_c1 3300050508 Unclassified 532
168 nmdc:mga09592_1992_c1 3300050508 Bacteria 16484
169 nmdc:mga09592_204283_c1 3300050508 Bacteria 1711
170 nmdc:mga09592_433085_c1 3300050508 Unclassified 1135
171 nmdc:mga09592_885781_c1 3300050508 Unclassified 751
172 nmdc:mga0qj67_228216_c1 3300050509 Bacteria 1511
173 nmdc:mga0qj67_403259_c1 3300050509 Bacteria 1103
174 nmdc:mga0qj67_480838_c1 3300050509 Bacteria 999
175 nmdc:mga06r32_1006317_c1 3300050510 Bacteria 786
176 nmdc:mga06r32_661685_c1 3300050510 Bacteria 1012
177 nmdc:mga0n895_1425219_c1 3300050512 Bacteria 661
178 nmdc:mga0n895_1515485_c1 3300050512 Unclassified 636
179 nmdc:mga0n895_334013_c1 3300050512 Bacteria 1535
180 Ga0501084_0155866 3300054114 Bacteria 1926
181 Ga0501084_0473511 3300054114 Unclassified 1059
182 Ga0501082_0436854 3300060353 Unclassified 1143
183 Ga0501082_1278635 3300060353 Unclassified 641
184 Ga0530510_1177292 3300061734 Bacteria 587
185 Ga0207709_10283007
186 SwRhRL2b_contig_3164769
187 MBSR1b_contig_10856210
188 MBSR1b_contig_2945480
189 Ga0065704_10185673
190 Ga0065707_10023055
191 Ga0065707_10082075
192 Ga0065707_10114173
193 Ga0065707_10163700
194 Ga0070689_100114888
195 Ga0070691_10531826
196 Ga0070692_10283999
197 Ga0070667_100233903
198 Ga0070700_100282635
199 Ga0070694_100034697
200 Ga0070694_100150984
201 Ga0070694_101415715
202 Ga0070706_101156236
203 Ga0070707_100294944
204 Ga0070707_100816306
205 Ga0070698_100016976
206 Ga0070698_100084512
207 Ga0070698_100130506
208 Ga0070698_100373335
209 Ga0070698_100482649
210 Ga0070699_100158068
211 Ga0070695_100243125
212 Ga0070695_100821621
213 Ga0070696_100069086
214 Ga0070696_101796776
215 Ga0068859_100520431
216 Ga0068859_101916094
217 Ga0068864_100024066
218 Ga0068870_10361464
219 Ga0068863_100033380
220 Ga0068862_100002570
221 Ga0068862_100158385
222 Ga0068862_101106271
223 Ga0068862_101307022
224 Ga0075363_100024648
225 Ga0070712_100308397
226 Ga0075427_10001933
227 Ga0075428_100125451
228 Ga0075428_100132972
229 Ga0075428_100316399
230 Ga0075428_100372722
231 Ga0075428_100828464
232 Ga0075428_102302019
233 Ga0075430_100184564
234 Ga0075430_100400012
235 Ga0075431_100091698
236 Ga0075431_100511817
237 Ga0075433_10235639
238 Ga0075434_100356094
239 Ga0075434_100360162
240 Ga0075429_100008873
241 Ga0075429_100101888
242 Ga0075429_100135236
243 Ga0075429_100255366
244 Ga0075429_100355054
245 Ga0075429_100470419
246 Ga0097620_100520427
247 Ga0097620_101916057
248 Ga0105240_10435209
249 Ga0111539_10052949
250 Ga0111539_12702821
251 Ga0105245_11453385
252 Ga0114129_10001019
253 Ga0114129_10024459
254 Ga0114129_10040857
255 Ga0114129_10092946
256 Ga0114129_10249386
257 Ga0114129_10449129
258 Ga0114129_10464677
259 Ga0114129_10830480
260 Ga0105243_10019237
261 Ga0105243_10215278
262 Ga0105249_10026853
263 Ga0105249_10204245
264 Ga0105249_10569260
265 Ga0105249_10755668
266 Ga0105249_10812951
267 Ga0105246_10116545
268 Ga0105246_10241681
269 Ga0163162_10811516
270 Ga0157380_10926208
271 Ga0207684_10083349
272 Ga0207660_10300835
273 Ga0207646_10390535
274 Ga0207646_10500408
275 Ga0207709_10010151
276 Ga0207709_10050485
277 Ga0207712_10112442
278 Ga0207703_10423456
279 Ga0207708_10254853
280 Ga0207676_10027121
281 Ga0207674_10163477
282 Ga0207675_100131750
283 Ga0268265_10025079
284 Ga0268265_11496798
285 Ga0265338_10405188
286 Ga0265340_10024278
287 Ga0265314_10241125
288 Ga0265342_10209508
289 Ga0307410_10470389
290 Ga0307410_11091945
291 Ga0307406_11230922
292 Ga0307407_10055417
293 Ga0307409_101514930
294 Ga0307416_100624914
295 Ga0451800_0149939
296 Ga0439445_0009587
297 Ga0439446_0030516
298 Ga0451577_0352060
299 Ga0451577_0708296
300 Ga0451577_0721054
301 Ga0451577_0876011
302 Ga0451577_0913007
303 Ga0453683_0006138
304 Ga0453683_0032263
305 Ga0453683_0060929
306 Ga0453683_0096486
307 Ga0453683_0113060
308 Ga0453683_0135710
309 Ga0453684_0007622
310 Ga0453684_0043141
311 Ga0453684_0155907
312 Ga0453684_0247811
313 Ga0453684_0388537
314 Ga0453684_0412398
315 Ga0453684_0416826
316 Ga0453684_0519672
317 Ga0453684_0570067
318 Ga0453684_0654223
319 Ga0453684_0852608
320 Ga0453684_1037660
321 Ga0453684_2104625
322 Ga0453684_2340866
323 Ga0451576_0000263
324 Ga0451576_0007007
325 Ga0451576_0059241
326 Ga0451576_0076396
327 Ga0451576_0083357
328 Ga0451576_0124968
329 Ga0451576_0588157
330 Ga0451576_0809602
331 Ga0501031_0557639
332 Ga0501041_0111368
333 Ga0501068_0135690
334 Ga0501071_0634545
335 Ga0501072_0392732
336 Ga0501072_0436834
337 Ga0501075_0874386
338 Ga0501076_0234953
339 Ga0501080_1445555
340 Ga0501045_0353826
341 nmdc:mga03n38_28780_c2
342 nmdc:mga06z11_62722_c1
343 nmdc:mga05p37_114589_c1
344 nmdc:mga05p37_4091_c1
345 nmdc:mga05p37_463853_c1
346 nmdc:mga05p37_488842_c1
347 nmdc:mga05p37_607119_c1
348 nmdc:mga09592_132284_c1
349 nmdc:mga09592_1347607_c1
350 nmdc:mga09592_13750_c1
351 nmdc:mga09592_1576920_c1
352 nmdc:mga09592_1992_c1
353 nmdc:mga09592_204283_c1
354 nmdc:mga09592_433085_c1
355 nmdc:mga09592_885781_c1
356 nmdc:mga0qj67_228216_c1
357 nmdc:mga0qj67_403259_c1
358 nmdc:mga0qj67_480838_c1
359 nmdc:mga06r32_1006317_c1
360 nmdc:mga06r32_661685_c1
361 nmdc:mga0n895_1425219_c1
362 nmdc:mga0n895_1515485_c1
363 nmdc:mga0n895_334013_c1
364 Ga0501084_0155866
365 Ga0501084_0473511
366 Ga0501082_0436854
367 Ga0501082_1278635
368 Ga0530510_1177292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

143

0.91

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

29

157

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

54

145

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

5

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.9522 6 152
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.9275 6 152
2dxq-assembly1.cif.gz_B putative acetyltransferase from agrobacterium tumefaciens str. c58 0.8725 7 152
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.863 6 147
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8536 5 146
ID Description Score Start End Superfamily
1z4eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9522 6 152 3.40.630.30
1z4eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9275 6 152 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9181 6 148 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9102 105 153 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8869 6 148 3.40.630.30
ID Description Score Start End GO Terms
AF-U4V1Y7-F1-model_v4 GNAT family acetyltransferase 0.988 6 146 GO:0016747
AF-A0A1G9FG71-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9844 6 149 GO:0005840
GO:0016747
AF-A0A439JPX9-F1-model_v4 deleted 0.9831 6 149
AF-A0A7Y7A5K7-F1-model_v4 deleted 0.9821 6 149
AF-A0A504KQF2-F1-model_v4 GNAT family N-acetyltransferase 0.9815 6 149 GO:0016747

Map