F284378

General Info

Members Datasets Scaffolds Average Seq Length
185 144 185 102

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_11592641|Ga0157377_115926412
Length 113
Sequence MLDPTVTPDRRREAMLCAHTIRRLKPGKFEEFAETFTPGGDQAPEGWVAFHMLRGLADENEVITFGFFDGTLEELESNQGRHGYEEIRDSVAPLVDEVLHNGIYEIVRSRTVA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.59
Metatranscriptomes 5.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 2.7
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1004831 3300002074 Bacteria 1552
2 JGI24034J26672_10000072 3300002239 Bacteria 25672
3 JGI24742J22300_10008620 3300002244 Unclassified 1683
4 Ga0058863_11973390 3300004799 Bacteria 879
5 Ga0058861_11694300 3300004800 Unclassified 681
6 Ga0058862_12746803 3300004803 Unclassified 577
7 Ga0070683_100023565 3300005329 Bacteria 5507
8 Ga0068869_100481581 3300005334 Bacteria 1033
9 Ga0068869_100631042 3300005334 Unclassified 908
10 Ga0068869_101870790 3300005334 Bacteria 537
11 Ga0070680_100042187 3300005336 Bacteria 3701
12 Ga0070680_100088952 3300005336 Bacteria 2555
13 Ga0070682_100544735 3300005337 Unclassified 907
14 Ga0070682_101590068 3300005337 Bacteria 565
15 Ga0068868_101247210 3300005338 Bacteria 689
16 Ga0068868_101988850 3300005338 Bacteria 551
17 Ga0070660_100563899 3300005339 Bacteria 950
18 Ga0070691_10093150 3300005341 Bacteria 1488
19 Ga0070661_100179862 3300005344 Bacteria 1609
20 Ga0070692_10088865 3300005345 Bacteria 1676
21 Ga0070675_101906000 3300005354 Unclassified 548
22 Ga0070671_100554476 3300005355 Bacteria 991
23 Ga0070674_101072493 3300005356 Unclassified 710
24 Ga0070673_101874500 3300005364 Bacteria 568
25 Ga0070659_100004476 3300005366 Bacteria 9984
26 Ga0070659_101959690 3300005366 Unclassified 526
27 Ga0070701_10203979 3300005438 Bacteria 1170
28 Ga0070700_101561191 3300005441 Unclassified 563
29 Ga0070662_101148080 3300005457 Unclassified 667
30 Ga0070681_10082582 3300005458 Bacteria 3168
31 Ga0070681_10239585 3300005458 Bacteria 1728
32 Ga0070681_10309278 3300005458 Bacteria 1490
33 Ga0070679_100087291 3300005530 Bacteria 3106
34 Ga0070679_100183077 3300005530 Bacteria 2067
35 Ga0070679_100340083 3300005530 Unclassified 1449
36 Ga0070679_100791104 3300005530 Bacteria 892
37 Ga0070684_100124407 3300005535 Bacteria 2322
38 Ga0070684_100354657 3300005535 Bacteria 1349
39 Ga0068853_100098902 3300005539 Bacteria 2576
40 Ga0070696_100962472 3300005546 Unclassified 711
41 Ga0070693_100214763 3300005547 Bacteria 1257
42 Ga0070665_100077036 3300005548 Bacteria 3341
43 Ga0070704_100517338 3300005549 Bacteria 1038
44 Ga0070664_100261631 3300005564 Bacteria 1557
45 Ga0068857_100199628 3300005577 Bacteria 1823
46 Ga0068854_100681277 3300005578 Bacteria 886
47 Ga0068856_100176831 3300005614 Bacteria 2147
48 Ga0068856_100948458 3300005614 Bacteria 879
49 Ga0070702_100166137 3300005615 Bacteria 1431
50 Ga0068852_100021999 3300005616 Bacteria 5103
51 Ga0068866_11030452 3300005718 Unclassified 586
52 Ga0068861_101898961 3300005719 Bacteria 592
53 Ga0068870_10443226 3300005840 Bacteria 854
54 Ga0068863_100000110 3300005841 Bacteria 86415
55 Ga0068862_101464609 3300005844 Unclassified 687
56 Ga0081455_10016924 3300005937 Bacteria 7009
57 Ga0081538_10033503 3300005981 Bacteria 3417
58 Ga0081538_10331621 3300005981 Bacteria 553
59 Ga0075430_100039055 3300006846 Bacteria 4020
60 Ga0075433_10000047 3300006852 Bacteria 50752
61 Ga0105240_10041924 3300009093 Bacteria 5837
62 Ga0111539_11116892 3300009094 Bacteria 916
63 Ga0105243_10394460 3300009148 Bacteria 1284
64 Ga0105243_11531836 3300009148 Archaea 691
65 Ga0105237_10079609 3300009545 Bacteria 3267
66 Ga0105238_10134011 3300009551 Bacteria 2455
67 Ga0105238_10775028 3300009551 Bacteria 974
68 Ga0105239_10365066 3300010375 Bacteria 1631
69 Ga0105239_11555549 3300010375 Unclassified 765
70 Ga0105239_12816499 3300010375 Unclassified 568
71 Ga0157373_10560182 3300013100 Archaea 829
72 Ga0157373_11233067 3300013100 Unclassified 564
73 Ga0157371_10098251 3300013102 Bacteria 2076
74 Ga0157370_10117737 3300013104 Unclassified 2482
75 Ga0157370_11802358 3300013104 Unclassified 549
76 Ga0157369_10052200 3300013105 Bacteria 4425
77 Ga0157369_10841475 3300013105 Bacteria 942
78 Ga0157372_10203832 3300013307 Bacteria 2292
79 Ga0157377_11592641 3300014745 Unclassified 523
80 Ga0197907_10638228 3300020069 Bacteria 875
81 Ga0206356_10263689 3300020070 Bacteria 969
82 Ga0206356_11855640 3300020070 Bacteria 911
83 Ga0206352_10851743 3300020078 Unclassified 591
84 Ga0206354_10429481 3300020081 Unclassified 647
85 Ga0206353_11067223 3300020082 Bacteria 1557
86 Ga0224712_10269485 3300022467 Bacteria 790
87 Ga0207672_1007562 3300025223 Unclassified 634
88 Ga0207688_10867879 3300025901 Unclassified 572
89 Ga0207707_10025385 3300025912 Bacteria 5184
90 Ga0207695_10041154 3300025913 Bacteria 4946
91 Ga0207671_10103688 3300025914 Bacteria 2157
92 Ga0207660_10425760 3300025917 Bacteria 1071
93 Ga0207657_10026461 3300025919 Bacteria 5332
94 Ga0207649_10078580 3300025920 Bacteria 2129
95 Ga0207652_10073671 3300025921 Bacteria 2972
96 Ga0207652_10128010 3300025921 Bacteria 2263
97 Ga0207652_10151111 3300025921 Bacteria 2079
98 Ga0207681_11415958 3300025923 Bacteria 583
99 Ga0207694_10050298 3300025924 Bacteria 3227
100 Ga0207694_11065658 3300025924 Bacteria 684
101 Ga0207690_10220385 3300025932 Bacteria 1451
102 Ga0207709_11823785 3300025935 Unclassified 506
103 Ga0207704_11355728 3300025938 Bacteria 609
104 Ga0207665_11201204 3300025939 Bacteria 605
105 Ga0207689_10309820 3300025942 Bacteria 1309
106 Ga0207689_11298172 3300025942 Bacteria 611
107 Ga0207661_10029352 3300025944 Bacteria 4223
108 Ga0207661_10345050 3300025944 Bacteria 1342
109 Ga0207679_10112790 3300025945 Bacteria 2149
110 Ga0207667_11063861 3300025949 Bacteria 794
111 Ga0207640_10576488 3300025981 Bacteria 949
112 Ga0207640_10953000 3300025981 Bacteria 752
113 Ga0207677_11204944 3300026023 Bacteria 693
114 Ga0207677_11974630 3300026023 Bacteria 542
115 Ga0207639_10341455 3300026041 Bacteria 1335
116 Ga0207678_11322607 3300026067 Bacteria 637
117 Ga0207702_10063379 3300026078 Bacteria 3161
118 Ga0207641_10000065 3300026088 Bacteria 156066
119 Ga0207675_100831290 3300026118 Unclassified 938
120 Ga0207683_11095317 3300026121 Bacteria 739
121 Ga0207698_10034558 3300026142 Bacteria 3686
122 Ga0268266_10144146 3300028379 Bacteria 2140
123 Ga0265337_1003531 3300028556 Bacteria 6741
124 Ga0265326_10106099 3300028558 Bacteria 797
125 Ga0265319_1001521 3300028563 Bacteria 13748
126 Ga0265334_10135761 3300028573 Unclassified 873
127 Ga0265318_10000815 3300028577 Bacteria 20578
128 Ga0265322_10011029 3300028654 Bacteria 2621
129 Ga0265336_10000002 3300028666 Bacteria 830172
130 Ga0265338_10000001 3300028800 Bacteria 1177449
131 Ga0265324_10023661 3300029957 Bacteria 2186
132 Ga0265332_10162191 3300031238 Bacteria 934
133 Ga0265320_10166843 3300031240 Bacteria 990
134 Ga0265340_10000001 3300031247 Bacteria 1647668
135 Ga0265339_10022960 3300031249 Bacteria 3610
136 Ga0265316_10010381 3300031344 Bacteria 8490
137 Ga0307405_10678543 3300031731 Bacteria 851
138 Ga0307410_10274704 3300031852 Bacteria 1320
139 Ga0307410_10741594 3300031852 Bacteria 831
140 Ga0307406_10089344 3300031901 Bacteria 2070
141 Ga0307406_10822101 3300031901 Bacteria 786
142 Ga0307407_11135756 3300031903 Bacteria 608
143 Ga0307412_11196011 3300031911 Bacteria 680
144 Ga0307412_11693932 3300031911 Bacteria 579
145 Ga0307409_101007214 3300031995 Bacteria 851
146 Ga0307409_101437638 3300031995 Bacteria 716
147 Ga0307416_100148873 3300032002 Bacteria 2143
148 Ga0307416_100981373 3300032002 Bacteria 947
149 Ga0307416_101313491 3300032002 Bacteria 829
150 Ga0307416_103256674 3300032002 Unclassified 543
151 Ga0307414_10545251 3300032004 Bacteria 1033
152 Ga0307414_10931295 3300032004 Bacteria 798
153 Ga0307411_10475402 3300032005 Bacteria 1051
154 Ga0307411_10910995 3300032005 Bacteria 782
155 Ga0307415_101339221 3300032126 Bacteria 679
156 Ga0395900_0030525 3300037418 Bacteria 5534
157 Ga0395898_0059131 3300037466 Bacteria 3730
158 Ga0395905_0023784 3300037471 Bacteria 5785
159 Ga0395901_0043505 3300038443 Bacteria 4658
160 Ga0395901_1346342 3300038443 Bacteria 674
161 Ga0436362_0496164 3300039453 Bacteria 508
162 Ga0451804_0875836 3300041463 Bacteria 553
163 Ga0451807_0940858 3300041486 Bacteria 1030
164 Ga0451833_0924293 3300041491 Bacteria 762
165 Ga0439450_138888 3300042008 Unclassified 633
166 Ga0466966_0195557 3300044684 Bacteria 1224
167 Ga0466967_0562675 3300045976 Bacteria 1123
168 Ga0466967_0609072 3300045976 Unclassified 1078
169 Ga0495603_0004890 3300046455 Bacteria 8013
170 Ga0495603_0207194 3300046455 Bacteria 1133
171 Ga0495594_0000001 3300046499 Bacteria 293051
172 Ga0495622_0000033 3300046557 Bacteria 124162
173 Ga0495657_0049337 3300046675 Bacteria 2836
174 Ga0495647_0089654 3300046681 Bacteria 1259
175 Ga0496106_0000101 3300048909 Bacteria 65644
176 Ga0496107_0284896 3300048910 Bacteria 1230
177 Ga0496113_0272085 3300048916 Bacteria 1354
178 Ga0501292_106807 3300049515 Bacteria 560
179 Ga0501042_0023873 3300049578 Bacteria 4283
180 Ga0501070_0863825 3300049586 Bacteria 707
181 nmdc:mga08y16_1643871_c1 3300050511 Bacteria 599
182 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
183 Ga0500650_0394967 3300053098 Bacteria 599
184 Ga0501084_1220027 3300054114 Bacteria 631
185 Ga0501082_0471769 3300060353 Bacteria 1097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100000110 Ga0068863_100000110101 87
2 3300026088 Ga0207641_10000065 Ga0207641_10000065170 87
3 3300009094 Ga0111539_11116892 Ga0111539_111168922 95
4 3300050511 nmdc:mga08y16_1643871_c1 nmdc:mga08y16_1643871_c1_21_308 95
5 3300028556 Ga0265337_1003531 Ga0265337_10035313 96
6 3300028558 Ga0265326_10106099 Ga0265326_101060992 96
7 3300028563 Ga0265319_1001521 Ga0265319_10015218 96
8 3300028573 Ga0265334_10135761 Ga0265334_101357612 96
9 3300028577 Ga0265318_10000815 Ga0265318_100008153 96
10 3300028654 Ga0265322_10011029 Ga0265322_100110293 96
11 3300028666 Ga0265336_10000002 Ga0265336_10000002734 96
12 3300028800 Ga0265338_10000001 Ga0265338_1000000178 96
13 3300029957 Ga0265324_10023661 Ga0265324_100236614 96
14 3300031238 Ga0265332_10162191 Ga0265332_101621912 96
15 3300031240 Ga0265320_10166843 Ga0265320_101668432 96
16 3300031247 Ga0265340_10000001 Ga0265340_1000000178 96
17 3300031249 Ga0265339_10022960 Ga0265339_100229602 96
18 3300031344 Ga0265316_10010381 Ga0265316_100103812 96
19 3300005840 Ga0068870_10443226 Ga0068870_104432262 97
20 3300037418 Ga0395900_0030525 Ga0395900_0030525_1468_1767 97
21 3300037466 Ga0395898_0059131 Ga0395898_0059131_1863_2162 97
22 3300037471 Ga0395905_0023784 Ga0395905_0023784_3104_3403 97
23 3300038443 Ga0395901_0043505 Ga0395901_0043505_1418_1717 97
24 3300038443 Ga0395901_1346342 Ga0395901_1346342_105_404 97
25 3300005334 Ga0068869_100481581 Ga0068869_1004815811 98
26 3300005337 Ga0070682_101590068 Ga0070682_1015900682 98
27 3300005354 Ga0070675_101906000 Ga0070675_1019060002 98
28 3300005356 Ga0070674_101072493 Ga0070674_1010724932 98
29 3300005457 Ga0070662_101148080 Ga0070662_1011480801 98
30 3300005530 Ga0070679_100183077 Ga0070679_1001830774 98
31 3300005546 Ga0070696_100962472 Ga0070696_1009624722 98
32 3300005548 Ga0070665_100077036 Ga0070665_1000770363 98
33 3300005549 Ga0070704_100517338 Ga0070704_1005173383 98
34 3300005615 Ga0070702_100166137 Ga0070702_1001661371 98
35 3300005844 Ga0068862_101464609 Ga0068862_1014646092 98
36 3300005937 Ga0081455_10016924 Ga0081455_100169242 98
37 3300009148 Ga0105243_10394460 Ga0105243_103944601 98
38 3300025901 Ga0207688_10867879 Ga0207688_108678792 98
39 3300025921 Ga0207652_10073671 Ga0207652_100736714 98
40 3300025923 Ga0207681_11415958 Ga0207681_114159582 98
41 3300025938 Ga0207704_11355728 Ga0207704_113557282 98
42 3300025942 Ga0207689_10309820 Ga0207689_103098202 98
43 3300025981 Ga0207640_10953000 Ga0207640_109530001 98
44 3300026118 Ga0207675_100831290 Ga0207675_1008312901 98
45 3300026121 Ga0207683_11095317 Ga0207683_110953171 98
46 3300028379 Ga0268266_10144146 Ga0268266_101441464 98
47 3300031852 Ga0307410_10741594 Ga0307410_107415941 98
48 3300032002 Ga0307416_101313491 Ga0307416_1013134912 98
49 3300004799 Ga0058863_11973390 Ga0058863_119733902 99
50 3300004800 Ga0058861_11694300 Ga0058861_116943002 99
51 3300004803 Ga0058862_12746803 Ga0058862_127468031 99
52 3300005329 Ga0070683_100023565 Ga0070683_1000235652 99
53 3300005334 Ga0068869_100631042 Ga0068869_1006310422 99
54 3300005336 Ga0070680_100042187 Ga0070680_1000421872 99
55 3300005336 Ga0070680_100088952 Ga0070680_1000889522 99
56 3300005337 Ga0070682_100544735 Ga0070682_1005447352 99
57 3300005338 Ga0068868_101247210 Ga0068868_1012472102 99
58 3300005338 Ga0068868_101988850 Ga0068868_1019888501 99
59 3300005339 Ga0070660_100563899 Ga0070660_1005638993 99
60 3300005341 Ga0070691_10093150 Ga0070691_100931504 99
61 3300005344 Ga0070661_100179862 Ga0070661_1001798623 99
62 3300005345 Ga0070692_10088865 Ga0070692_100888652 99
63 3300005355 Ga0070671_100554476 Ga0070671_1005544762 99
64 3300005364 Ga0070673_101874500 Ga0070673_1018745001 99
65 3300005366 Ga0070659_100004476 Ga0070659_1000044766 99
66 3300005366 Ga0070659_101959690 Ga0070659_1019596901 99
67 3300005441 Ga0070700_101561191 Ga0070700_1015611912 99
68 3300005458 Ga0070681_10082582 Ga0070681_100825824 99
69 3300005458 Ga0070681_10239585 Ga0070681_102395853 99
70 3300005458 Ga0070681_10309278 Ga0070681_103092781 99
71 3300005530 Ga0070679_100087291 Ga0070679_1000872914 99
72 3300005530 Ga0070679_100340083 Ga0070679_1003400831 99
73 3300005530 Ga0070679_100791104 Ga0070679_1007911042 99
74 3300005535 Ga0070684_100124407 Ga0070684_1001244073 99
75 3300005535 Ga0070684_100354657 Ga0070684_1003546572 99
76 3300005539 Ga0068853_100098902 Ga0068853_1000989024 99
77 3300005547 Ga0070693_100214763 Ga0070693_1002147632 99
78 3300005564 Ga0070664_100261631 Ga0070664_1002616313 99
79 3300005577 Ga0068857_100199628 Ga0068857_1001996282 99
80 3300005578 Ga0068854_100681277 Ga0068854_1006812772 99
81 3300005614 Ga0068856_100176831 Ga0068856_1001768313 99
82 3300005614 Ga0068856_100948458 Ga0068856_1009484582 99
83 3300005616 Ga0068852_100021999 Ga0068852_1000219996 99
84 3300005718 Ga0068866_11030452 Ga0068866_110304521 99
85 3300005981 Ga0081538_10033503 Ga0081538_100335034 99
86 3300005981 Ga0081538_10331621 Ga0081538_103316211 99
87 3300009093 Ga0105240_10041924 Ga0105240_100419248 99
88 3300009148 Ga0105243_11531836 Ga0105243_115318362 99
89 3300009545 Ga0105237_10079609 Ga0105237_100796094 99
90 3300009551 Ga0105238_10134011 Ga0105238_101340114 99
91 3300009551 Ga0105238_10775028 Ga0105238_107750281 99
92 3300010375 Ga0105239_10365066 Ga0105239_103650662 99
93 3300010375 Ga0105239_11555549 Ga0105239_115555492 99
94 3300010375 Ga0105239_12816499 Ga0105239_128164992 99
95 3300013100 Ga0157373_10560182 Ga0157373_105601821 99
96 3300013100 Ga0157373_11233067 Ga0157373_112330671 99
97 3300013102 Ga0157371_10098251 Ga0157371_100982514 99
98 3300013104 Ga0157370_10117737 Ga0157370_101177374 99
99 3300013104 Ga0157370_11802358 Ga0157370_118023581 99
100 3300013105 Ga0157369_10052200 Ga0157369_100522002 99
101 3300013105 Ga0157369_10841475 Ga0157369_108414751 99
102 3300013307 Ga0157372_10203832 Ga0157372_102038322 99
103 3300014745 Ga0157377_11592641 Ga0157377_115926412 99
104 3300020069 Ga0197907_10638228 Ga0197907_106382281 99
105 3300020070 Ga0206356_10263689 Ga0206356_102636891 99
106 3300020070 Ga0206356_11855640 Ga0206356_118556401 99
107 3300020078 Ga0206352_10851743 Ga0206352_108517431 99
108 3300020081 Ga0206354_10429481 Ga0206354_104294812 99
109 3300020082 Ga0206353_11067223 Ga0206353_110672232 99
110 3300022467 Ga0224712_10269485 Ga0224712_102694851 99
111 3300025912 Ga0207707_10025385 Ga0207707_100253856 99
112 3300025913 Ga0207695_10041154 Ga0207695_100411545 99
113 3300025914 Ga0207671_10103688 Ga0207671_101036884 99
114 3300025917 Ga0207660_10425760 Ga0207660_104257601 99
115 3300025919 Ga0207657_10026461 Ga0207657_100264613 99
116 3300025920 Ga0207649_10078580 Ga0207649_100785803 99
117 3300025921 Ga0207652_10128010 Ga0207652_101280104 99
118 3300025921 Ga0207652_10151111 Ga0207652_101511114 99
119 3300025924 Ga0207694_10050298 Ga0207694_100502984 99
120 3300025924 Ga0207694_11065658 Ga0207694_110656582 99
121 3300025932 Ga0207690_10220385 Ga0207690_102203852 99
122 3300025935 Ga0207709_11823785 Ga0207709_118237852 99
123 3300025939 Ga0207665_11201204 Ga0207665_112012041 99
124 3300025944 Ga0207661_10029352 Ga0207661_100293526 99
125 3300025944 Ga0207661_10345050 Ga0207661_103450502 99
126 3300025945 Ga0207679_10112790 Ga0207679_101127903 99
127 3300025949 Ga0207667_11063861 Ga0207667_110638611 99
128 3300025981 Ga0207640_10576488 Ga0207640_105764883 99
129 3300026023 Ga0207677_11204944 Ga0207677_112049442 99
130 3300026023 Ga0207677_11974630 Ga0207677_119746302 99
131 3300026041 Ga0207639_10341455 Ga0207639_103414554 99
132 3300026067 Ga0207678_11322607 Ga0207678_113226071 99
133 3300026078 Ga0207702_10063379 Ga0207702_100633794 99
134 3300026142 Ga0207698_10034558 Ga0207698_100345585 99
135 3300031901 Ga0307406_10822101 Ga0307406_108221012 99
136 3300031995 Ga0307409_101437638 Ga0307409_1014376382 99
137 3300032002 Ga0307416_103256674 Ga0307416_1032566741 99
138 3300041463 Ga0451804_0875836 Ga0451804_0875836_146_454 99
139 3300041491 Ga0451833_0924293 Ga0451833_0924293_83_391 99
140 3300042008 Ga0439450_138888 Ga0439450_138888_121_420 99
141 3300044684 Ga0466966_0195557 Ga0466966_0195557_44_346 99
142 3300045976 Ga0466967_0562675 Ga0466967_0562675_88_402 99
143 3300048916 Ga0496113_0272085 Ga0496113_0272085_932_1231 99
144 3300049586 Ga0501070_0863825 Ga0501070_0863825_223_525 99
145 3300054114 Ga0501084_1220027 Ga0501084_1220027_30_332 99
146 3300060353 Ga0501082_0471769 Ga0501082_0471769_343_645 99
147 3300002074 JGI24748J21848_1004831 JGI24748J21848_10048312 100
148 3300002239 JGI24034J26672_10000072 JGI24034J26672_1000007224 100
149 3300002244 JGI24742J22300_10008620 JGI24742J22300_100086202 100
150 3300005334 Ga0068869_101870790 Ga0068869_1018707901 100
151 3300005438 Ga0070701_10203979 Ga0070701_102039793 100
152 3300005719 Ga0068861_101898961 Ga0068861_1018989612 100
153 3300006846 Ga0075430_100039055 Ga0075430_1000390553 100
154 3300006852 Ga0075433_10000047 Ga0075433_1000004756 100
155 3300025223 Ga0207672_1007562 Ga0207672_10075622 100
156 3300025942 Ga0207689_11298172 Ga0207689_112981722 100
157 3300031731 Ga0307405_10678543 Ga0307405_106785432 100
158 3300031852 Ga0307410_10274704 Ga0307410_102747043 100
159 3300031901 Ga0307406_10089344 Ga0307406_100893441 100
160 3300031903 Ga0307407_11135756 Ga0307407_111357562 100
161 3300031911 Ga0307412_11196011 Ga0307412_111960112 100
162 3300031911 Ga0307412_11693932 Ga0307412_116939322 100
163 3300031995 Ga0307409_101007214 Ga0307409_1010072142 100
164 3300032002 Ga0307416_100148873 Ga0307416_1001488732 100
165 3300032002 Ga0307416_100981373 Ga0307416_1009813731 100
166 3300032004 Ga0307414_10545251 Ga0307414_105452512 100
167 3300032004 Ga0307414_10931295 Ga0307414_109312952 100
168 3300032005 Ga0307411_10475402 Ga0307411_104754023 100
169 3300032005 Ga0307411_10910995 Ga0307411_109109952 100
170 3300032126 Ga0307415_101339221 Ga0307415_1013392212 100
171 3300039453 Ga0436362_0496164 Ga0436362_0496164_64_369 100
172 3300041486 Ga0451807_0940858 Ga0451807_0940858_639_941 100
173 3300045976 Ga0466967_0609072 Ga0466967_0609072_63_365 100
174 3300046455 Ga0495603_0004890 Ga0495603_0004890_82_384 100
175 3300046455 Ga0495603_0207194 Ga0495603_0207194_177_512 100
176 3300046499 Ga0495594_0000001 Ga0495594_0000001_90327_90632 100
177 3300046557 Ga0495622_0000033 Ga0495622_0000033_3425_3730 100
178 3300046675 Ga0495657_0049337 Ga0495657_0049337_1296_1631 100
179 3300046681 Ga0495647_0089654 Ga0495647_0089654_401_703 100
180 3300048909 Ga0496106_0000101 Ga0496106_0000101_28481_28786 100
181 3300048910 Ga0496107_0284896 Ga0496107_0284896_550_855 100
182 3300049515 Ga0501292_106807 Ga0501292_106807_101_403 100
183 3300049578 Ga0501042_0023873 Ga0501042_0023873_506_808 100
184 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_185351_185653 100
185 3300053098 Ga0500650_0394967 Ga0500650_0394967_39_341 100

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8238 2 94
4dn9-assembly1.cif.gz_A crystal structure of putative antibiotic biosynthesis monooxygenase from chloroflexus aurantiacus j-10-fl 0.8185 2 100
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.8166 1 94
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.8162 2 95
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8033 1 95
ID Description Score Start End Superfamily
4dn9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8386 1 99 3.30.70.100
4dn9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8308 1 99 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8295 2 94 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8288 2 94 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8034 1 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W0Z7U5-F1-model_v4 ABM domain-containing protein 0.8888 1 99
AF-Q11BZ7-F1-model_v4 ABM domain-containing protein 0.8782 2 100
AF-A0A7V9M9K0-F1-model_v4 Uncharacterized protein 0.875 2 97
AF-A0A7Y7B1L0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.8743 2 98 GO:0004497
AF-A0A1F2XSZ0-F1-model_v4 ABM domain-containing protein 0.8729 2 98

Feature Viewer

pLDDT pTM Quality
87.8 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map