F284174

General Info

Members Datasets Scaffolds Average Seq Length
185 135 370 178

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100773186|Ga0075431_1007731862
Length 204
Sequence VSESERRSSSPLVGEGWDGGLPPHEQRGTVLAVHRSPTHSFSKRTALAIRLIAGLGVEGDAHAGETVKHRSRVARDPTQPNLRQVHLIHAELLDELNAAGFNVKPGDMGENITTRGLDLLVLPTGTLLMIGTAVIRLTGLRNPCVQLDRFQQGLMQATLDRDPDGNLIRKAGVMGVVLDGGDIQMGEGIRVRLPHQERRPLQPV

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
103 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
132 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
133 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
134 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
135 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0.54
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.54
Rhizoplane 2.7
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100773186 3300006847 Bacteria 935
2 JGI25159J45721_1001692 3300002987 Bacteria 8927
3 Ga0065165_1001711 3300005262 Bacteria 22014
4 Ga0065704_10344851 3300005289 Bacteria 810
5 Ga0065715_10182748 3300005293 Bacteria 1465
6 Ga0065707_10112681 3300005295 Bacteria 2350
7 Ga0070670_100451109 3300005331 Bacteria 1140
8 Ga0070691_10000121 3300005341 Bacteria 23636
9 Ga0070661_100047336 3300005344 Bacteria 3147
10 Ga0070668_100370688 3300005347 Bacteria 1216
11 Ga0070669_100012181 3300005353 Bacteria 6104
12 Ga0070674_100003995 3300005356 Bacteria 8359
13 Ga0070688_101029329 3300005365 Bacteria 655
14 Ga0070709_10000385 3300005434 Bacteria 27159
15 Ga0070709_10012597 3300005434 Bacteria 4735
16 Ga0070714_100009943 3300005435 Bacteria 7504
17 Ga0070714_100202624 3300005435 Bacteria 1816
18 Ga0070713_100000011 3300005436 Bacteria 146314
19 Ga0070713_100612883 3300005436 Bacteria 1035
20 Ga0070713_100641521 3300005436 Bacteria 1011
21 Ga0070711_100129743 3300005439 Bacteria 1876
22 Ga0070711_100731088 3300005439 Bacteria 835
23 Ga0070705_100403082 3300005440 Bacteria 1013
24 Ga0070694_100297406 3300005444 Bacteria 1236
25 Ga0070699_100110084 3300005518 Bacteria 2418
26 Ga0070697_100179784 3300005536 Bacteria 1793
27 Ga0070695_100097116 3300005545 Bacteria 1978
28 Ga0068855_100367344 3300005563 Bacteria 1582
29 Ga0068857_100001620 3300005577 Bacteria 18072
30 Ga0068857_100044935 3300005577 Bacteria 3918
31 Ga0068856_100000324 3300005614 Bacteria 52557
32 Ga0068856_100001837 3300005614 Bacteria 22221
33 Ga0068852_100007344 3300005616 Bacteria 8039
34 Ga0068861_100883280 3300005719 Bacteria 845
35 Ga0068858_101067800 3300005842 Bacteria 792
36 Ga0068862_100013612 3300005844 Bacteria 6737
37 Ga0068862_100569490 3300005844 Bacteria 1084
38 Ga0081455_10018631 3300005937 Bacteria 6598
39 Ga0081538_10007612 3300005981 Bacteria 9338
40 Ga0075365_10163726 3300006038 Bacteria 1551
41 Ga0070712_100000014 3300006175 Bacteria 108668
42 Ga0070712_100000873 3300006175 Bacteria 17996
43 Ga0075428_100026484 3300006844 Bacteria 6418
44 Ga0075428_100101731 3300006844 Bacteria 3132
45 Ga0075428_100217267 3300006844 Bacteria 2065
46 Ga0075430_100002695 3300006846 Bacteria 14826
47 Ga0075430_100906571 3300006846 Bacteria 726
48 Ga0075431_100432481 3300006847 Bacteria 1314
49 Ga0075434_100095345 3300006871 Bacteria 2981
50 Ga0075429_100718296 3300006880 Bacteria 875
51 Ga0075436_100000158 3300006914 Bacteria 42114
52 Ga0075436_100004553 3300006914 Bacteria 9495
53 Ga0075436_100160474 3300006914 Bacteria 1585
54 Ga0105240_10027026 3300009093 Bacteria 7522
55 Ga0111539_10000612 3300009094 Bacteria 46198
56 Ga0111539_10033220 3300009094 Bacteria 6265
57 Ga0111539_10034215 3300009094 Bacteria 6164
58 Ga0111539_10798257 3300009094 Bacteria 1099
59 Ga0114129_10039386 3300009147 Bacteria 6662
60 Ga0114129_10182761 3300009147 Bacteria 2852
61 Ga0114129_11007380 3300009147 Unclassified 1049
62 Ga0105243_11170570 3300009148 Bacteria 781
63 Ga0105241_10003918 3300009174 Bacteria 11028
64 Ga0105248_10215073 3300009177 Bacteria 2165
65 Ga0105237_10070863 3300009545 Bacteria 3481
66 Ga0105237_10688516 3300009545 Bacteria 1029
67 Ga0105238_10015406 3300009551 Bacteria 7737
68 Ga0105249_10658252 3300009553 Bacteria 1105
69 Ga0099796_10119299 3300010159 Unclassified 1012
70 Ga0105239_10006962 3300010375 Bacteria 13026
71 Ga0105239_12194960 3300010375 Bacteria 642
72 Ga0157373_10001822 3300013100 Bacteria 16230
73 Ga0157370_10001820 3300013104 Bacteria 26266
74 Ga0157369_10005003 3300013105 Bacteria 15524
75 Ga0157378_10043120 3300013297 Bacteria 4005
76 Ga0157378_10912500 3300013297 Bacteria 910
77 Ga0163162_11944977 3300013306 Bacteria 673
78 Ga0157372_10328008 3300013307 Bacteria 1782
79 Ga0157380_10117813 3300014326 Bacteria 2244
80 Ga0157380_10178114 3300014326 Bacteria 1865
81 Ga0157380_10535054 3300014326 Bacteria 1146
82 Ga0157379_10001757 3300014968 Bacteria 17909
83 Ga0157379_10008158 3300014968 Bacteria 9095
84 Ga0157379_10828064 3300014968 Bacteria 875
85 Ga0182007_10051317 3300015262 Bacteria 1361
86 Ga0163161_10360222 3300017792 Bacteria 1158
87 Ga0206353_11081343 3300020082 Bacteria 1429
88 Ga0209130_1000080 3300025284 Bacteria 166684
89 Ga0207680_10574363 3300025903 Bacteria 806
90 Ga0207699_10000340 3300025906 Bacteria 24823
91 Ga0207695_10062618 3300025913 Bacteria 3839
92 Ga0207671_10072841 3300025914 Bacteria 2565
93 Ga0207693_10000239 3300025915 Bacteria 50617
94 Ga0207693_10000248 3300025915 Bacteria 49938
95 Ga0207681_10097388 3300025923 Bacteria 2114
96 Ga0207681_10215661 3300025923 Bacteria 1482
97 Ga0207700_10000005 3300025928 Bacteria 394836
98 Ga0207664_10027749 3300025929 Bacteria 4297
99 Ga0207664_10065979 3300025929 Bacteria 2900
100 Ga0207669_10088512 3300025937 Bacteria 2008
101 Ga0207665_10012330 3300025939 Bacteria 5615
102 Ga0207665_10611554 3300025939 Bacteria 852
103 Ga0207691_10647316 3300025940 Bacteria 893
104 Ga0207711_10136462 3300025941 Bacteria 2204
105 Ga0207667_10002638 3300025949 Bacteria 22170
106 Ga0207658_10024834 3300025986 Bacteria 4194
107 Ga0207703_10062281 3300026035 Bacteria 3056
108 Ga0207703_10653803 3300026035 Bacteria 997
109 Ga0207702_10000173 3300026078 Bacteria 77458
110 Ga0207702_10003440 3300026078 Bacteria 14455
111 Ga0207674_10000584 3300026116 Bacteria 47996
112 Ga0207674_10055209 3300026116 Bacteria 4040
113 Ga0207675_100417271 3300026118 Bacteria 1325
114 Ga0207675_100629256 3300026118 Unclassified 1078
115 Ga0207428_10000217 3300027907 Bacteria 79759
116 Ga0207428_10061242 3300027907 Bacteria 2980
117 Ga0207428_10224771 3300027907 Bacteria 1406
118 Ga0268266_10717786 3300028379 Bacteria 964
119 Ga0307413_10028241 3300031824 Bacteria 3121
120 Ga0307410_10034731 3300031852 Bacteria 3269
121 Ga0307410_10586133 3300031852 Bacteria 928
122 Ga0307407_10447188 3300031903 Bacteria 937
123 Ga0307409_100138328 3300031995 Bacteria 2094
124 Ga0307409_100192069 3300031995 Bacteria 1818
125 Ga0307416_100231931 3300032002 Bacteria 1780
126 Ga0307414_11310885 3300032004 Bacteria 672
127 Ga0307411_10026843 3300032005 Bacteria 3473
128 Ga0307415_100205528 3300032126 Bacteria 1566
129 Ga0373928_0023812 3300035084 Bacteria 1308
130 Ga0373934_0018905 3300035086 Bacteria 2640
131 Ga0373956_0107085 3300035119 Bacteria 1299
132 Ga0373943_0057555 3300035170 Bacteria 1932
133 Ga0373924_0301155 3300035410 Bacteria 712
134 Ga0373931_0038243 3300035691 Bacteria 2509
135 Ga0373931_0878017 3300035691 Bacteria 602
136 Ga0373927_0108183 3300035695 Bacteria 1811
137 Ga0373927_0690331 3300035695 Bacteria 674
138 Ga0373947_0910091 3300035725 Bacteria 600
139 Ga0373937_0014780 3300036401 Bacteria 6892
140 Ga0373937_0164062 3300036401 Bacteria 2083
141 Ga0373937_0943867 3300036401 Bacteria 811
142 Ga0373937_0989645 3300036401 Bacteria 790
143 Ga0373925_0011352 3300037068 Bacteria 6464
144 Ga0373925_0265875 3300037068 Bacteria 1379
145 Ga0395905_0828954 3300037471 Bacteria 828
146 Ga0436364_1149423 3300037853 Bacteria 148108
147 Ga0400485_18620 3300038735 Bacteria 1438
148 Ga0439453_0001817 3300041408 Bacteria 2828
149 Ga0439466_0133660 3300041411 Bacteria 763
150 Ga0439441_073582 3300042001 Bacteria 736
151 Ga0439435_0000137 3300042436 Bacteria 9765
152 Ga0439464_0053530 3300042439 Bacteria 1171
153 Ga0439460_0020087 3300042461 Bacteria 1814
154 Ga0451576_1371206 3300045051 Bacteria 736
155 Ga0466958_1086787 3300045836 Unclassified 522
156 Ga0495617_151740 3300046452 Unclassified 737
157 Ga0495603_0502200 3300046455 Bacteria 694
158 Ga0495594_0537624 3300046499 Bacteria 663
159 Ga0495671_0025281 3300046692 Bacteria 3088
160 Ga0495636_0245027 3300047318 Bacteria 828
161 Ga0496102_0291658 3300048905 Bacteria 1538
162 Ga0496107_0074976 3300048910 Bacteria 2462
163 Ga0496109_0263636 3300048912 Bacteria 1623
164 Ga0496110_0891731 3300048913 Bacteria 795
165 Ga0496115_0146734 3300048918 Bacteria 1947
166 Ga0501031_0549807 3300049568 Bacteria 744
167 Ga0501042_0016376 3300049578 Bacteria 5086
168 nmdc:mga06z11_794952_c1 3300050494 Bacteria 576
169 nmdc:mga05p37_502389_c1 3300050507 Bacteria 1391
170 nmdc:mga0qj67_14_c1 3300050509 Bacteria 124768
171 nmdc:mga0qj67_278624_c1 3300050509 Bacteria 1355
172 nmdc:mga06r32_502396_c1 3300050510 Bacteria 1189
173 nmdc:mga06r32_692287_c1 3300050510 Bacteria 985
174 nmdc:mga08y16_1420345_c1 3300050511 Bacteria 657
175 nmdc:mga08y16_88_c1 3300050511 Bacteria 77244
176 nmdc:mga0n895_91635_c1 3300050512 Bacteria 3042
177 nmdc:mga0rr50_36782_c1 3300050513 Bacteria 3528
178 nmdc:mga08x19_143081_c1 3300050514 Bacteria 1616
179 nmdc:mga08x19_41736_c1 3300050514 Bacteria 2922
180 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
181 Ga0500594_0001818 3300053118 Bacteria 4620
182 2509075690 2508501114 Bacteria 7082538
183 2526060456 2524614857 Bacteria 4146328
184 2566035882 2565956521 Bacteria 4468993
185 2740063186 2739367875 Bacteria 4157290
186 Ga0075431_100773186
187 JGI25159J45721_1001692
188 Ga0065165_1001711
189 Ga0065704_10344851
190 Ga0065715_10182748
191 Ga0065707_10112681
192 Ga0070670_100451109
193 Ga0070691_10000121
194 Ga0070661_100047336
195 Ga0070668_100370688
196 Ga0070669_100012181
197 Ga0070674_100003995
198 Ga0070688_101029329
199 Ga0070709_10000385
200 Ga0070709_10012597
201 Ga0070714_100009943
202 Ga0070714_100202624
203 Ga0070713_100000011
204 Ga0070713_100612883
205 Ga0070713_100641521
206 Ga0070711_100129743
207 Ga0070711_100731088
208 Ga0070705_100403082
209 Ga0070694_100297406
210 Ga0070699_100110084
211 Ga0070697_100179784
212 Ga0070695_100097116
213 Ga0068855_100367344
214 Ga0068857_100001620
215 Ga0068857_100044935
216 Ga0068856_100000324
217 Ga0068856_100001837
218 Ga0068852_100007344
219 Ga0068861_100883280
220 Ga0068858_101067800
221 Ga0068862_100013612
222 Ga0068862_100569490
223 Ga0081455_10018631
224 Ga0081538_10007612
225 Ga0075365_10163726
226 Ga0070712_100000014
227 Ga0070712_100000873
228 Ga0075428_100026484
229 Ga0075428_100101731
230 Ga0075428_100217267
231 Ga0075430_100002695
232 Ga0075430_100906571
233 Ga0075431_100432481
234 Ga0075434_100095345
235 Ga0075429_100718296
236 Ga0075436_100000158
237 Ga0075436_100004553
238 Ga0075436_100160474
239 Ga0105240_10027026
240 Ga0111539_10000612
241 Ga0111539_10033220
242 Ga0111539_10034215
243 Ga0111539_10798257
244 Ga0114129_10039386
245 Ga0114129_10182761
246 Ga0114129_11007380
247 Ga0105243_11170570
248 Ga0105241_10003918
249 Ga0105248_10215073
250 Ga0105237_10070863
251 Ga0105237_10688516
252 Ga0105238_10015406
253 Ga0105249_10658252
254 Ga0099796_10119299
255 Ga0105239_10006962
256 Ga0105239_12194960
257 Ga0157373_10001822
258 Ga0157370_10001820
259 Ga0157369_10005003
260 Ga0157378_10043120
261 Ga0157378_10912500
262 Ga0163162_11944977
263 Ga0157372_10328008
264 Ga0157380_10117813
265 Ga0157380_10178114
266 Ga0157380_10535054
267 Ga0157379_10001757
268 Ga0157379_10008158
269 Ga0157379_10828064
270 Ga0182007_10051317
271 Ga0163161_10360222
272 Ga0206353_11081343
273 Ga0209130_1000080
274 Ga0207680_10574363
275 Ga0207699_10000340
276 Ga0207695_10062618
277 Ga0207671_10072841
278 Ga0207693_10000239
279 Ga0207693_10000248
280 Ga0207681_10097388
281 Ga0207681_10215661
282 Ga0207700_10000005
283 Ga0207664_10027749
284 Ga0207664_10065979
285 Ga0207669_10088512
286 Ga0207665_10012330
287 Ga0207665_10611554
288 Ga0207691_10647316
289 Ga0207711_10136462
290 Ga0207667_10002638
291 Ga0207658_10024834
292 Ga0207703_10062281
293 Ga0207703_10653803
294 Ga0207702_10000173
295 Ga0207702_10003440
296 Ga0207674_10000584
297 Ga0207674_10055209
298 Ga0207675_100417271
299 Ga0207675_100629256
300 Ga0207428_10000217
301 Ga0207428_10061242
302 Ga0207428_10224771
303 Ga0268266_10717786
304 Ga0307413_10028241
305 Ga0307410_10034731
306 Ga0307410_10586133
307 Ga0307407_10447188
308 Ga0307409_100138328
309 Ga0307409_100192069
310 Ga0307416_100231931
311 Ga0307414_11310885
312 Ga0307411_10026843
313 Ga0307415_100205528
314 Ga0373928_0023812
315 Ga0373934_0018905
316 Ga0373956_0107085
317 Ga0373943_0057555
318 Ga0373924_0301155
319 Ga0373931_0038243
320 Ga0373931_0878017
321 Ga0373927_0108183
322 Ga0373927_0690331
323 Ga0373947_0910091
324 Ga0373937_0014780
325 Ga0373937_0164062
326 Ga0373937_0943867
327 Ga0373937_0989645
328 Ga0373925_0011352
329 Ga0373925_0265875
330 Ga0395905_0828954
331 Ga0436364_1149423
332 Ga0400485_18620
333 Ga0439453_0001817
334 Ga0439466_0133660
335 Ga0439441_073582
336 Ga0439435_0000137
337 Ga0439464_0053530
338 Ga0439460_0020087
339 Ga0451576_1371206
340 Ga0466958_1086787
341 Ga0495617_151740
342 Ga0495603_0502200
343 Ga0495594_0537624
344 Ga0495671_0025281
345 Ga0495636_0245027
346 Ga0496102_0291658
347 Ga0496107_0074976
348 Ga0496109_0263636
349 Ga0496110_0891731
350 Ga0496115_0146734
351 Ga0501031_0549807
352 Ga0501042_0016376
353 nmdc:mga06z11_794952_c1
354 nmdc:mga05p37_502389_c1
355 nmdc:mga0qj67_14_c1
356 nmdc:mga0qj67_278624_c1
357 nmdc:mga06r32_502396_c1
358 nmdc:mga06r32_692287_c1
359 nmdc:mga08y16_1420345_c1
360 nmdc:mga08y16_88_c1
361 nmdc:mga0n895_91635_c1
362 nmdc:mga0rr50_36782_c1
363 nmdc:mga08x19_143081_c1
364 nmdc:mga08x19_41736_c1
365 nmdc:mga08x19_62_c1
366 Ga0500594_0001818
367 2509075690
368 2526060456
369 2566035882
370 2740063186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

58

190

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8039 1 167
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.8037 1 166
3t07-assembly1.cif.gz_C crystal structure of s. aureus pyruvate kinase in complex with a naturally occurring bis-indole alkaloid 0.7963 84 166
1o65-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7682 1 166
1o67-assembly3.cif.gz_C crystal structure of an hypothetical protein 0.764 1 166
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.797 1 170 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7679 1 170 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7402 3 174 2.40.33.20
af_U4PC34_202_334_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7383 56 164 2.40.33.20
af_P9WKE5_72_166_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7346 82 166 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A387HRZ8-F1-model_v4 MOSC domain-containing protein 0.999 2 179 GO:0003824
GO:0030151
GO:0030170
AF-A0A1M7QCV3-F1-model_v4 MOSC domain-containing protein YiiM 0.9983 2 179 GO:0003824
GO:0030151
GO:0030170
AF-A0A327U1J2-F1-model_v4 MOSC domain-containing protein YiiM 0.9981 2 179 GO:0003824
GO:0030151
GO:0030170
AF-A0A2W1W8Y0-F1-model_v4 deleted 0.9973 2 179
AF-A0A7T9YPC6-F1-model_v4 deleted 0.9973 2 179

Map