F283667

General Info

Members Datasets Scaffolds Average Seq Length
185 143 123 155

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070569|Ga0065704_1007056911
Length 158
Sequence MKLSDVKQILLALENVEFQLEDGTFVPEHFHVTEVGIIQKHFIDCGGTVRHEKAVSFQLWNADDFEHRLKPNKLLHIIQLSEEKLGIEDSEIEVEYQSETIGKYDLDFNGKTFVLKNKTTACLAQEACGIPSPKQKVALSGLQATADASRCAPNSGCC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
12 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
13 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
14 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
17 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
18 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
21 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
22 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
23 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
24 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
25 2739367663 Pedobacter sp. YR510 Isolate Unclassified
26 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
27 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
28 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
29 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
30 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
31 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
32 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
33 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
34 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
35 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
38 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
39 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
40 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
41 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
42 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
43 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
44 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
45 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
46 2914759650 Rhizosphaericola mali Isolate Rhizosphere
47 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
48 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
49 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
50 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
51 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
52 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
53 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
54 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
55 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
56 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
57 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
58 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
136 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
137 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
140 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
141 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
142 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
143 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.78
Metatranscriptomes 2.16
Isolates 34.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.54
Rhizoplane 3.78
Rhizosphere 68.11
Stem 0
Stem Tuber 0
Unclassified 22.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1064540 2162886007 Bacteria 2674
2 SwRhRL2b_contig_3726454 2162886007 Bacteria 2438
3 MBSR1b_contig_5579916 2162886012 Bacteria 913
4 rootH2_10056677 3300003320 Bacteria 3559
5 rootL2_10003853 3300003322 Bacteria 1712
6 rootH1_10066562 3300003316 Bacteria 2260
7 rootH1_10066562 3300003323 Bacteria 6083
8 Ga0006562J51391_1032876 3300003578 Bacteria 680
9 Ga0055536_1000003 3300003781 Bacteria 447744
10 Ga0055534_1010161 3300003784 Bacteria 1993
11 Ga0055530_10002762 3300003791 Bacteria 10865
12 Ga0065714_10010147 3300005288 Bacteria 3470
13 Ga0065704_10001522 3300005289 Bacteria 7441
14 Ga0065704_10070569 3300005289 Bacteria 20309
15 Ga0065704_10073700 3300005289 Bacteria 6873
16 Ga0065704_10081172 3300005289 Bacteria 3809
17 Ga0065704_10082181 3300005289 Bacteria 3641
18 Ga0065704_10088167 3300005289 Bacteria 2961
19 Ga0065704_10238125 3300005289 Bacteria 1018
20 Ga0065704_10291983 3300005289 Bacteria 901
21 Ga0065715_10286412 3300005293 Bacteria 1073
22 Ga0070682_100000063 3300005337 Bacteria 101553
23 Ga0070668_100577160 3300005347 Bacteria 981
24 Ga0070678_100021743 3300005456 Unclassified 4237
25 Ga0070716_100075449 3300006173 Bacteria 1995
26 Ga0075362_10345262 3300006177 Bacteria 744
27 Ga0068871_101266277 3300006358 Bacteria 693
28 Ga0105244_10000004 3300009036 Bacteria 492478
29 Ga0105244_10000060 3300009036 Bacteria 127191
30 Ga0105243_10000002 3300009148 Bacteria 856281
31 Ga0105243_10000145 3300009148 Bacteria 81468
32 Ga0157373_10000002 3300013100 Bacteria 750094
33 Ga0157371_10000079 3300013102 Bacteria 152295
34 Ga0157371_10281643 3300013102 Bacteria 1201
35 Ga0157370_10000399 3300013104 Bacteria 54642
36 Ga0157370_10000770 3300013104 Bacteria 40150
37 Ga0157370_10004350 3300013104 Bacteria 16262
38 Ga0157370_10017224 3300013104 Bacteria 7291
39 Ga0157370_10134406 3300013104 Bacteria 2306
40 Ga0157370_10134513 3300013104 Bacteria 2305
41 Ga0157369_10008862 3300013105 Bacteria 11522
42 Ga0163162_11041009 3300013306 Unclassified 926
43 Ga0163162_11541552 3300013306 Bacteria 757
44 Ga0157375_10358008 3300013308 Bacteria 1625
45 Ga0157375_10677922 3300013308 Bacteria 1186
46 Ga0157375_10962061 3300013308 Bacteria 995
47 Ga0157380_10337345 3300014326 Unclassified 1404
48 Ga0182008_10000054 3300014497 Bacteria 102738
49 Ga0182006_1000003 3300015261 Bacteria 826681
50 Ga0182006_1000999 3300015261 Bacteria 18510
51 Ga0182006_1025695 3300015261 Bacteria 2417
52 Ga0182006_1040700 3300015261 Bacteria 1828
53 Ga0163161_10000007 3300017792 Bacteria 301614
54 Ga0163161_10000070 3300017792 Bacteria 103561
55 Ga0163161_10003829 3300017792 Bacteria 10549
56 Ga0163161_10205117 3300017792 Bacteria 1521
57 Ga0163161_11173871 3300017792 Bacteria 663
58 Ga0209675_1000056 3300025291 Bacteria 187664
59 Ga0209676_1000001 3300025292 Bacteria 1852142
60 Ga0209050_1000016 3300025298 Bacteria 729149
61 Ga0207655_1000008 3300025728 Bacteria 734289
62 Ga0207655_1000591 3300025728 Bacteria 44587
63 Ga0207709_10000003 3300025935 Bacteria 1050072
64 Ga0207709_10000509 3300025935 Bacteria 34265
65 Ga0207665_10233821 3300025939 Bacteria 1352
66 Ga0207668_11882529 3300025972 Bacteria 539
67 Ga0207678_10226899 3300026067 Bacteria 1599
68 Ga0207683_10050603 3300026121 Unclassified 3640
69 Ga0307405_10000001 3300031731 Bacteria 1731270
70 Ga0307406_10015410 3300031901 Bacteria 4423
71 Ga0307412_10751458 3300031911 Bacteria 842
72 Ga0307414_10000001 3300032004 Bacteria 1352954
73 Ga0307414_10106587 3300032004 Bacteria 2122
74 Ga0307411_10511414 3300032005 Bacteria 1017
75 Ga0439465_0013304 3300041413 Bacteria 2568
76 Ga0451791_0134442 3300041451 Bacteria 595
77 Ga0451807_1321114 3300041486 Bacteria 820
78 Ga0451853_1900262 3300041512 Unclassified 758
79 Ga0495627_000002 3300046453 Bacteria 903861
80 Ga0495627_008061 3300046453 Bacteria 3972
81 Ga0495596_0000915 3300046500 Bacteria 17580
82 Ga0495607_0100426 3300046501 Bacteria 1551
83 Ga0495606_0018590 3300046507 Bacteria 5203
84 Ga0495606_0436438 3300046507 Bacteria 674
85 Ga0495663_0000062 3300046525 Bacteria 50363
86 Ga0495633_0319859 3300046558 Bacteria 704
87 Ga0495660_0257874 3300046810 Bacteria 806
88 Ga0495686_0000079 3300047472 Bacteria 202668
89 Ga0495686_0000516 3300047472 Bacteria 55884
90 Ga0495686_0006068 3300047472 Bacteria 9370
91 Ga0496104_0133483 3300048907 Bacteria 2385
92 Ga0496105_0056742 3300048908 Bacteria 3233
93 Ga0496110_0090369 3300048913 Bacteria 2738
94 Ga0496113_0067642 3300048916 Bacteria 2709
95 Ga0496114_0175252 3300048917 Bacteria 1871
96 Ga0496116_0000012 3300048919 Bacteria 611365
97 Ga0496117_0000139 3300048920 Bacteria 158612
98 Ga0496118_0000129 3300048921 Bacteria 134056
99 Ga0496119_0000002 3300048922 Bacteria 738385
100 Ga0496121_0065478 3300048924 Bacteria 2956
101 Ga0496122_0000207 3300048925 Bacteria 131493
102 Ga0496122_0001431 3300048925 Bacteria 38654
103 Ga0496123_0002712 3300048926 Bacteria 21272
104 Ga0496123_0007851 3300048926 Bacteria 9925
105 Ga0496124_0006171 3300048927 Bacteria 13140
106 Ga0496124_0057110 3300048927 Bacteria 3290
107 Ga0496125_0000208 3300048928 Bacteria 122812
108 Ga0496125_0002797 3300048928 Bacteria 22053
109 Ga0496126_0001353 3300048929 Bacteria 38881
110 Ga0496126_0255516 3300048929 Bacteria 1459
111 Ga0501320_001400 3300049536 Bacteria 1763
112 Ga0501323_008164 3300049539 Bacteria 1211
113 Ga0501335_008902 3300049551 Bacteria 950
114 Ga0501198_000767 3300049649 Bacteria 3994
115 Ga0501223_007631 3300049663 Bacteria 2213
116 Ga0501235_107944 3300049669 Bacteria 686
117 Ga0501249_000009 3300049679 Bacteria 173938
118 Ga0501241_001687 3300049758 Bacteria 4413
119 Ga0501241_024205 3300049758 Bacteria 1127
120 Ga0501269_000035 3300049766 Bacteria 41924
121 Ga0500594_0217040 3300053118 Bacteria 631
122 Ga0500559_0193607 3300053136 Bacteria 958
123 Ga0500584_015503 3300053726 Bacteria 3505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000516 Ga0495686_0000516_1487_1903 138
2 3300046507 Ga0495606_0436438 Ga0495606_0436438_189_662 141
3 3300046501 Ga0495607_0100426 Ga0495607_0100426_566_1039 143
4 3300005289 Ga0065704_10001522 Ga0065704_100015229 146
5 3300005289 Ga0065704_10238125 Ga0065704_102381251 146
6 3300009148 Ga0105243_10000002 Ga0105243_10000002579 146
7 iso_pu_bacteria 2588254257 2590612097 146
8 iso_pu_bacteria 2890804823 2890807243 147
9 3300025935 Ga0207709_10000003 Ga0207709_10000003588 148
10 iso_pu_bacteria 2965320100 2965320115 148
11 3300048917 Ga0496114_0175252 Ga0496114_0175252_950_1402 150
12 iso_pu_bacteria 2887375801 2887380146 150
13 iso_pu_bacteria 2890737413 2890738465 150
14 iso_pu_bacteria 2898713307 2898716336 150
15 iso_pu_bacteria 2914759650 2914760682 150
16 iso_pu_bacteria 2945924605 2945926469 150
17 iso_pu_bacteria 8036736890 8036739294 150
18 3300015261 Ga0182006_1000003 Ga0182006_1000003264 151
19 iso_pu_bacteria 2519899754 2520879272 151
20 iso_pu_bacteria 2739367663 2739644495 151
21 iso_pu_bacteria 2739367857 2740001898 151
22 iso_pu_bacteria 2739367858 2740006714 151
23 iso_pu_bacteria 2902048731 2902053061 151
24 3300005289 Ga0065704_10291983 Ga0065704_102919831 152
25 3300041486 Ga0451807_1321114 Ga0451807_1321114_343_801 152
26 iso_pu_bacteria 2585428184 2588220075 152
27 iso_pu_bacteria 2643221725 2644685126 152
28 iso_pu_bacteria 2802428842 2802654039 152
29 iso_pu_bacteria 2977243572 2977244985 152
30 iso_pu_bacteria 2977268062 2977269850 152
31 iso_pu_bacteria 2513020052 2513236400 153
32 iso_pu_bacteria 2519899754 2520879170 153
33 iso_pu_bacteria 2523533629 2524006740 153
34 iso_pu_bacteria 2582581278 2585142808 153
35 iso_pu_bacteria 2582581873 2585424230 153
36 iso_pu_bacteria 2585428045 2587679599 153
37 iso_pu_bacteria 2585428061 2587751486 153
38 iso_pu_bacteria 2585428115 2587943453 153
39 iso_pu_bacteria 2585428182 2588208698 153
40 iso_pu_bacteria 2585428183 2588212772 153
41 iso_pu_bacteria 2585428185 2588224305 153
42 iso_pu_bacteria 2588253712 2588444149 153
43 iso_pu_bacteria 2643221600 2644011369 153
44 iso_pu_bacteria 2728369107 2729202280 153
45 iso_pu_bacteria 2738541273 2738700140 153
46 iso_pu_bacteria 2738541279 2738732041 153
47 iso_pu_bacteria 2738541285 2738764606 153
48 iso_pu_bacteria 2738543007 2739213621 153
49 iso_pu_bacteria 2738543014 2739253889 153
50 iso_pu_bacteria 2751185877 2753671729 153
51 iso_pu_bacteria 2772190705 2772606632 153
52 iso_pu_bacteria 2775506739 2775671982 153
53 iso_pu_bacteria 2816332188 2816872377 153
54 iso_pu_bacteria 2857613821 2857614776 153
55 iso_pu_bacteria 2857618242 2857618516 153
56 iso_pu_bacteria 2871720351 2871721437 153
57 iso_pu_bacteria 2881359912 2881360033 153
58 iso_pu_bacteria 2889290771 2889292201 153
59 iso_pu_bacteria 2896344016 2896345281 153
60 iso_pu_bacteria 2902048731 2902052129 153
61 iso_pu_bacteria 2903895155 2903896059 153
62 iso_pu_bacteria 2904780799 2904785464 153
63 iso_pu_bacteria 2919097161 2919098580 153
64 iso_pu_bacteria 2919177583 2919179244 153
65 iso_pu_bacteria 2919191525 2919193961 153
66 iso_pu_bacteria 2919399522 2919399603 153
67 iso_pu_bacteria 2919509842 2919513431 153
68 iso_pu_bacteria 2929150217 2929153473 153
69 iso_pu_bacteria 2945924605 2945926475 153
70 iso_pu_bacteria 2993372514 2993374313 153
71 iso_pu_bacteria 2993480792 2993481208 153
72 iso_pu_bacteria 8054307821 8054309649 153
73 iso_pu_bacteria 8055419101 8055419225 153
74 iso_pu_bacteria 8055592153 8055592401 153
75 3300003781 Ga0055536_1000003 Ga0055536_1000003238 154
76 3300003791 Ga0055530_10002762 Ga0055530_100027627 154
77 3300025292 Ga0209676_1000001 Ga0209676_1000001571 154
78 3300025298 Ga0209050_1000016 Ga0209050_1000016236 154
79 3300013308 Ga0157375_10358008 Ga0157375_103580083 155
80 3300017792 Ga0163161_10000070 Ga0163161_1000007082 155
81 3300031911 Ga0307412_10751458 Ga0307412_107514582 155
82 3300041451 Ga0451791_0134442 Ga0451791_0134442_43_510 155
83 3300049758 Ga0501241_001687 Ga0501241_001687_55_522 155
84 3300053136 Ga0500559_0193607 Ga0500559_0193607_331_798 155
85 2162886012 MBSR1b_contig_5579916 MBSR1b_0882.00002160 156
86 3300005293 Ga0065715_10286412 Ga0065715_102864122 156
87 3300005456 Ga0070678_100021743 Ga0070678_1000217433 156
88 3300006173 Ga0070716_100075449 Ga0070716_1000754492 156
89 3300006358 Ga0068871_101266277 Ga0068871_1012662771 156
90 3300013100 Ga0157373_10000002 Ga0157373_10000002178 156
91 3300013104 Ga0157370_10000399 Ga0157370_1000039926 156
92 3300013306 Ga0163162_11041009 Ga0163162_110410092 156
93 3300013306 Ga0163162_11541552 Ga0163162_115415521 156
94 3300013308 Ga0157375_10677922 Ga0157375_106779222 156
95 3300013308 Ga0157375_10962061 Ga0157375_109620612 156
96 3300014326 Ga0157380_10337345 Ga0157380_103373452 156
97 3300015261 Ga0182006_1000999 Ga0182006_10009997 156
98 3300017792 Ga0163161_10205117 Ga0163161_102051172 156
99 3300017792 Ga0163161_11173871 Ga0163161_111738712 156
100 3300025939 Ga0207665_10233821 Ga0207665_102338212 156
101 3300026067 Ga0207678_10226899 Ga0207678_102268992 156
102 3300026121 Ga0207683_10050603 Ga0207683_100506034 156
103 3300041512 Ga0451853_1900262 Ga0451853_1900262_163_633 156
104 3300046500 Ga0495596_0000915 Ga0495596_0000915_2227_2697 156
105 3300048927 Ga0496124_0057110 Ga0496124_0057110_2537_3007 156
106 2162886007 SwRhRL2b_contig_3726454 SwRhRL2b_0783.00007760 157
107 3300003320 rootH2_10056677 rootH2_100566773 157
108 3300003322 rootL2_10003853 rootL2_100038532 157
109 3300003323 rootH1_10066562 rootH1_100665624 157
110 3300003578 Ga0006562J51391_1032876 Ga0006562J51391_10328761 157
111 3300003784 Ga0055534_1010161 Ga0055534_10101612 157
112 3300005288 Ga0065714_10010147 Ga0065714_100101473 157
113 3300005289 Ga0065704_10073700 Ga0065704_100737003 157
114 3300005289 Ga0065704_10081172 Ga0065704_100811728 157
115 3300005289 Ga0065704_10082181 Ga0065704_100821815 157
116 3300005289 Ga0065704_10088167 Ga0065704_100881671 157
117 3300005337 Ga0070682_100000063 Ga0070682_1000000632 157
118 3300005347 Ga0070668_100577160 Ga0070668_1005771602 157
119 3300006177 Ga0075362_10345262 Ga0075362_103452622 157
120 3300009036 Ga0105244_10000004 Ga0105244_10000004279 157
121 3300009036 Ga0105244_10000060 Ga0105244_100000607 157
122 3300009148 Ga0105243_10000145 Ga0105243_1000014575 157
123 3300013102 Ga0157371_10000079 Ga0157371_1000007964 157
124 3300013102 Ga0157371_10281643 Ga0157371_102816432 157
125 3300013104 Ga0157370_10000770 Ga0157370_1000077013 157
126 3300013104 Ga0157370_10004350 Ga0157370_1000435012 157
127 3300013104 Ga0157370_10134406 Ga0157370_101344063 157
128 3300013104 Ga0157370_10134513 Ga0157370_101345133 157
129 3300013105 Ga0157369_10008862 Ga0157369_1000886211 157
130 3300014497 Ga0182008_10000054 Ga0182008_1000005429 157
131 3300015261 Ga0182006_1025695 Ga0182006_10256951 157
132 3300015261 Ga0182006_1040700 Ga0182006_10407001 157
133 3300017792 Ga0163161_10000007 Ga0163161_10000007264 157
134 3300017792 Ga0163161_10003829 Ga0163161_1000382910 157
135 3300025291 Ga0209675_1000056 Ga0209675_100005611 157
136 3300025728 Ga0207655_1000008 Ga0207655_1000008309 157
137 3300025728 Ga0207655_1000591 Ga0207655_10005915 157
138 3300025935 Ga0207709_10000509 Ga0207709_1000050918 157
139 3300025972 Ga0207668_11882529 Ga0207668_118825291 157
140 3300032004 Ga0307414_10000001 Ga0307414_100000011049 157
141 3300032004 Ga0307414_10106587 Ga0307414_101065873 157
142 3300032005 Ga0307411_10511414 Ga0307411_105114142 157
143 3300041413 Ga0439465_0013304 Ga0439465_0013304_412_885 157
144 3300046453 Ga0495627_000002 Ga0495627_000002_81581_82054 157
145 3300046453 Ga0495627_008061 Ga0495627_008061_3479_3952 157
146 3300046507 Ga0495606_0018590 Ga0495606_0018590_2344_2817 157
147 3300046525 Ga0495663_0000062 Ga0495663_0000062_24773_25246 157
148 3300046558 Ga0495633_0319859 Ga0495633_0319859_191_664 157
149 3300046810 Ga0495660_0257874 Ga0495660_0257874_174_647 157
150 3300047472 Ga0495686_0000079 Ga0495686_0000079_83114_83587 157
151 3300047472 Ga0495686_0006068 Ga0495686_0006068_1755_2228 157
152 3300048907 Ga0496104_0133483 Ga0496104_0133483_1418_1894 157
153 3300048908 Ga0496105_0056742 Ga0496105_0056742_1685_2161 157
154 3300048913 Ga0496110_0090369 Ga0496110_0090369_2172_2645 157
155 3300048916 Ga0496113_0067642 Ga0496113_0067642_1329_1805 157
156 3300048919 Ga0496116_0000012 Ga0496116_0000012_413705_414181 157
157 3300048920 Ga0496117_0000139 Ga0496117_0000139_130843_131319 157
158 3300048921 Ga0496118_0000129 Ga0496118_0000129_24720_25196 157
159 3300048922 Ga0496119_0000002 Ga0496119_0000002_710771_711247 157
160 3300048924 Ga0496121_0065478 Ga0496121_0065478_2020_2493 157
161 3300048925 Ga0496122_0000207 Ga0496122_0000207_16434_16910 157
162 3300048925 Ga0496122_0001431 Ga0496122_0001431_28942_29415 157
163 3300048926 Ga0496123_0002712 Ga0496123_0002712_17031_17507 157
164 3300048926 Ga0496123_0007851 Ga0496123_0007851_3542_4015 157
165 3300048927 Ga0496124_0006171 Ga0496124_0006171_4620_5096 157
166 3300048928 Ga0496125_0000208 Ga0496125_0000208_108869_109342 157
167 3300048928 Ga0496125_0002797 Ga0496125_0002797_12317_12793 157
168 3300048929 Ga0496126_0001353 Ga0496126_0001353_34972_35445 157
169 3300048929 Ga0496126_0255516 Ga0496126_0255516_689_1162 157
170 3300049536 Ga0501320_001400 Ga0501320_001400_229_702 157
171 3300049539 Ga0501323_008164 Ga0501323_008164_581_1054 157
172 3300049551 Ga0501335_008902 Ga0501335_008902_96_569 157
173 3300049649 Ga0501198_000767 Ga0501198_000767_3496_3969 157
174 3300049663 Ga0501223_007631 Ga0501223_007631_1046_1519 157
175 3300049669 Ga0501235_107944 Ga0501235_107944_97_570 157
176 3300049679 Ga0501249_000009 Ga0501249_000009_60754_61227 157
177 3300049758 Ga0501241_024205 Ga0501241_024205_456_929 157
178 3300049766 Ga0501269_000035 Ga0501269_000035_41258_41731 157
179 3300053118 Ga0500594_0217040 Ga0500594_0217040_71_544 157
180 3300053726 Ga0500584_015503 Ga0500584_015503_2932_3405 157
181 2162886007 SwRhRL2b_contig_1064540 SwRhRL2b_0936.00004520 158
182 3300005289 Ga0065704_10070569 Ga0065704_1007056911 158
183 3300013104 Ga0157370_10017224 Ga0157370_100172243 158
184 3300031731 Ga0307405_10000001 Ga0307405_100000011236 158
185 3300031901 Ga0307406_10015410 Ga0307406_100154106 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20001

DUF6428

Family of unknown function (DUF6428)

22

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nja-assembly1.cif.gz_B the crystal structure of the pas domain of a ggdef family protein from chromobacterium violaceum atcc 12472. 0.7589 34 63
6pkh-assembly1.cif.gz_A-2 zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.7267 31 55
6pki-assembly2.cif.gz_D zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.7157 31 55
6pki-assembly2.cif.gz_C zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.7112 31 55
3lwn-assembly2.cif.gz_G shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex b) 0.6977 34 56
ID Description Score Start End Superfamily
af_A0A0N7KE18_310_445_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6896 31 55 1.10.238.10
af_A7MCD1_65_163_2.10.90.10 Mainly Beta;Ribbon;Cystine Knot Cytokines, subunit B;Cystine-knot cytokines 0.6771 30 55 2.10.90.10
af_P27539_262_372_2.10.90.10 Mainly Beta;Ribbon;Cystine Knot Cytokines, subunit B;Cystine-knot cytokines 0.6558 30 55 2.10.90.10
af_F1R5Z7_277_391_2.10.90.10 Mainly Beta;Ribbon;Cystine Knot Cytokines, subunit B;Cystine-knot cytokines 0.6482 30 55 2.10.90.10
af_F4IJB6_279_399_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6477 35 55 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3B9FQC5-F1-model_v4 DUF4160 domain-containing protein 0.9541 1 116
AF-A0A653ZJS5-F1-model_v4 Uncharacterized protein 0.9428 1 132
AF-A0A3B9FQC5-F1-model_v4 DUF4160 domain-containing protein 0.9385 1 116
AF-A0A653ZJS5-F1-model_v4 Uncharacterized protein 0.936 1 132
AF-A0A7Y2GN06-F1-model_v4 Uncharacterized protein 0.9226 1 96

Feature Viewer

pLDDT pTM Quality
82.65 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map