F283460

General Info

Members Datasets Scaffolds Average Seq Length
184 149 171 542

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2849281842|2849282745
Length 580
Sequence KIPPLGTRIKKGLFEKVEQPYYFTFLMLKNWILYLAIIATLFSCKKGTENPIQETGTTLPTYAFADLKVNGTYNGFTYYGLNNTPIVKITFSSPINLSSVGENITFTDASGNPAAFTSKLENNDNTVVISPSALQPITKYILNINTGLLSKAGNKLQSAIVVNLITAIDDADKFARIGDDELLTLVQKETFKYFWDFGHPTSGLARERNTSGNIVTSGGSGFGIMAMITGVNRNFISRADGLTRMQKIVAFLKTADRFHGAYPHWLDGNTGKVIPFSTKDNGGDLVETSFLMAGLITARQYFNGTDAAETALRADINAIYSGVEWNWYRKDNSNTLYWHWSPNYNWDMNLPIKGWNECLITYVMAAASPTFSIPKTVYDNGWAQNGAMKNGNTYYGVQLPLGTANGGPLFFSHYSFLGINPTGLSDTYANYETQTKAHTLINYNYCKANPLNNYGYSESCWGLTASDIPNGYTASAPGNDVGVIAPTAALSSFPYTPTESMQALKYFYYKLGNKTWGEYGFYDAFSLKDQWFASSTLAIDQGPIIVMIENYRTKLIWNLFMSAPEVKAGMKNLGFNSPNL

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2739367663 Pedobacter sp. YR510 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
10 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
11 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
12 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
13 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
138 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
147 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
148 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 1.09
Isolates 7.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 0
Rhizoplane 0
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10002688 3300002077 Bacteria 3626
2 JGI25152J39213_1000208 3300002773 Bacteria 39726
3 JGI25150J39212_1000014 3300002774 Bacteria 170955
4 JGI25151J46595_10000042 3300003187 Bacteria 170955
5 JGI25153J46596_10000009 3300003215 Bacteria 340925
6 rootH1_10101526 3300003316 Bacteria 4254
7 rootH2_10011933 3300003320 Bacteria 68387
8 rootH1_10049848 3300003323 Bacteria 11830
9 Ga0055536_1000019 3300003781 Bacteria 203087
10 Ga0055530_10004277 3300003791 Bacteria 7458
11 Ga0058863_10047299 3300004799 Bacteria 8498
12 Ga0058862_10124592 3300004803 Bacteria 7965
13 Ga0065714_10002330 3300005288 Bacteria 30957
14 Ga0065714_10064590 3300005288 Bacteria 31027
15 Ga0065704_10071739 3300005289 Bacteria 10051
16 Ga0065712_10068858 3300005290 Bacteria 8735
17 Ga0070676_10002056 3300005328 Bacteria 10235
18 Ga0070680_100016449 3300005336 Bacteria 5822
19 Ga0070660_100035851 3300005339 Bacteria 3755
20 Ga0070671_100002443 3300005355 Bacteria 14366
21 Ga0070663_100009720 3300005455 Bacteria 5969
22 Ga0070662_100000087 3300005457 Bacteria 50586
23 Ga0068867_100003170 3300005459 Bacteria 11601
24 Ga0070679_100017212 3300005530 Bacteria 6991
25 Ga0068853_100008400 3300005539 Bacteria 8294
26 Ga0070665_100000264 3300005548 Bacteria 85867
27 Ga0068855_100114061 3300005563 Bacteria 3099
28 Ga0068855_100191709 3300005563 Bacteria 2305
29 Ga0068852_100006661 3300005616 Bacteria 8370
30 Ga0068866_10007155 3300005718 Bacteria 4666
31 Ga0075366_10001297 3300006195 Bacteria 12449
32 Ga0097621_100000140 3300006237 Bacteria 43299
33 Ga0068871_100000195 3300006358 Bacteria 41566
34 Ga0068871_100011656 3300006358 Bacteria 6454
35 Ga0068865_100000060 3300006881 Bacteria 58604
36 Ga0105240_10011658 3300009093 Bacteria 12219
37 Ga0105240_10082467 3300009093 Bacteria 3949
38 Ga0105240_10094990 3300009093 Bacteria 3636
39 Ga0105240_10165938 3300009093 Bacteria 2619
40 Ga0105245_10147694 3300009098 Bacteria 2219
41 Ga0105241_10000755 3300009174 Bacteria 24591
42 Ga0105241_10004746 3300009174 Bacteria 10017
43 Ga0105242_10002120 3300009176 Bacteria 15650
44 Ga0105242_10022848 3300009176 Bacteria 4925
45 Ga0105248_10202039 3300009177 Bacteria 2239
46 Ga0105237_10000271 3300009545 Bacteria 73094
47 Ga0105237_10001121 3300009545 Bacteria 35908
48 Ga0105237_10003758 3300009545 Bacteria 17881
49 Ga0105238_10002992 3300009551 Bacteria 16886
50 Ga0105239_10006242 3300010375 Bacteria 13856
51 Ga0157373_10067335 3300013100 Bacteria 2532
52 Ga0157371_10000220 3300013102 Bacteria 83813
53 Ga0157371_10002117 3300013102 Bacteria 19329
54 Ga0157370_10013286 3300013104 Bacteria 8487
55 Ga0157370_10013358 3300013104 Bacteria 8459
56 Ga0157370_10014387 3300013104 Bacteria 8091
57 Ga0157370_10038113 3300013104 Unclassified 4652
58 Ga0157370_10072086 3300013104 Bacteria 3259
59 Ga0157369_10000031 3300013105 Bacteria 203214
60 Ga0157369_10000507 3300013105 Bacteria 51275
61 Ga0157369_10128229 3300013105 Bacteria 2689
62 Ga0157374_10000550 3300013296 Bacteria 33496
63 Ga0157374_10003929 3300013296 Bacteria 12479
64 Ga0163162_10000008 3300013306 Bacteria 316194
65 Ga0157372_10000048 3300013307 Bacteria 142757
66 Ga0157372_10093431 3300013307 Bacteria 3423
67 Ga0157372_10105245 3300013307 Bacteria 3227
68 Ga0157375_10115111 3300013308 Bacteria 2792
69 Ga0182008_10000555 3300014497 Bacteria 27671
70 Ga0157376_10021988 3300014969 Bacteria 4962
71 Ga0182006_1003827 3300015261 Bacteria 7563
72 Ga0182007_10000002 3300015262 Bacteria 564661
73 Ga0163161_10000445 3300017792 Bacteria 34489
74 Ga0163161_10000500 3300017792 Bacteria 32187
75 Ga0163161_10000900 3300017792 Bacteria 23093
76 Ga0207425_1000023 3300025245 Bacteria 341339
77 Ga0209026_1000615 3300025250 Bacteria 22806
78 Ga0209129_1000032 3300025258 Bacteria 341150
79 Ga0209676_1000009 3300025292 Bacteria 981719
80 Ga0209025_1000047 3300025294 Bacteria 341150
81 Ga0209758_1000145 3300025297 Bacteria 170553
82 Ga0209050_1000094 3300025298 Bacteria 242893
83 Ga0207647_10000416 3300025904 Bacteria 35091
84 Ga0207645_10017251 3300025907 Bacteria 4768
85 Ga0207654_10021279 3300025911 Bacteria 3447
86 Ga0207695_10000058 3300025913 Bacteria 366582
87 Ga0207695_10016140 3300025913 Bacteria 8759
88 Ga0207695_10137174 3300025913 Bacteria 2398
89 Ga0207695_10171056 3300025913 Bacteria 2098
90 Ga0207671_10001014 3300025914 Bacteria 34383
91 Ga0207671_10003517 3300025914 Bacteria 15549
92 Ga0207660_10003963 3300025917 Bacteria 9646
93 Ga0207652_10007691 3300025921 Bacteria 8665
94 Ga0207694_10002991 3300025924 Bacteria 13554
95 Ga0207644_10004341 3300025931 Bacteria 9199
96 Ga0207706_10000013 3300025933 Bacteria 188236
97 Ga0207686_10002594 3300025934 Bacteria 9808
98 Ga0207686_10013671 3300025934 Bacteria 4497
99 Ga0207704_10000028 3300025938 Bacteria 122144
100 Ga0207703_10122566 3300026035 Bacteria 2234
101 Ga0207639_10008251 3300026041 Bacteria 7135
102 Ga0207678_10016949 3300026067 Bacteria 6398
103 Ga0207641_10015273 3300026088 Bacteria 6293
104 Ga0207648_10000173 3300026089 Bacteria 66953
105 Ga0207683_10001258 3300026121 Bacteria 23008
106 Ga0207698_10002495 3300026142 Bacteria 10918
107 Ga0268266_10000268 3300028379 Bacteria 85976
108 Ga0307515_10081404 3300028794 Bacteria 4206
109 Ga0265338_10031073 3300028800 Bacteria 5243
110 Ga0307408_100001496 3300031548 Bacteria 17333
111 Ga0307408_100002350 3300031548 Bacteria 13360
112 Ga0307408_100079494 3300031548 Bacteria 2447
113 Ga0307508_10000327 3300031616 Bacteria 57384
114 Ga0307516_10074353 3300031730 Bacteria 3254
115 Ga0307405_10000015 3300031731 Bacteria 206299
116 Ga0307412_10000341 3300031911 Bacteria 29338
117 Ga0307414_10112288 3300032004 Bacteria 2077
118 Ga0307510_10004226 3300033180 Bacteria 16874
119 Ga0307510_10044979 3300033180 Bacteria 4773
120 Ga0395899_0000011 3300037312 Bacteria 521331
121 Ga0395899_0001558 3300037312 Bacteria 19316
122 Ga0395898_0006028 3300037466 Bacteria 13018
123 Ga0395905_0000781 3300037471 Bacteria 41778
124 Ga0436365_0708671 3300039437 Bacteria 1392
125 Ga0439448_0011069 3300042005 Bacteria 2683
126 Ga0451577_0000185 3300042876 Bacteria 131957
127 Ga0453683_0000283 3300044673 Bacteria 65980
128 Ga0466966_0065118 3300044684 Bacteria 2293
129 Ga0453684_0000602 3300044712 Bacteria 132457
130 Ga0451576_0000249 3300045051 Bacteria 132236
131 Ga0495592_0044996 3300046454 Bacteria 3295
132 Ga0495606_0017873 3300046507 Bacteria 5339
133 Ga0495606_0025515 3300046507 Bacteria 4231
134 Ga0495608_0033876 3300046511 Bacteria 3450
135 Ga0495610_0000232 3300046512 Bacteria 59379
136 Ga0495630_0015501 3300046517 Bacteria 5566
137 Ga0495648_0003738 3300046524 Bacteria 13265
138 Ga0495587_0028879 3300046536 Bacteria 3370
139 Ga0495633_0000004 3300046558 Bacteria 370781
140 Ga0495668_0000011 3300046616 Bacteria 472186
141 Ga0495634_0102967 3300046642 Unclassified 1843
142 Ga0495625_0002878 3300046660 Bacteria 18005
143 Ga0495687_000518 3300047443 Bacteria 46210
144 Ga0495686_0002568 3300047472 Bacteria 16912
145 Ga0496122_0000395 3300048925 Bacteria 92779
146 Ga0496123_0006024 3300048926 Bacteria 11929
147 Ga0501034_0000004 3300049571 Bacteria 382255
148 Ga0501034_0002888 3300049571 Bacteria 19981
149 Ga0501036_0136001 3300049572 Bacteria 2074
150 Ga0501039_0066755 3300049575 Bacteria 2793
151 Ga0501043_0004858 3300049579 Bacteria 10861
152 Ga0501046_0034770 3300049580 Bacteria 4064
153 Ga0501047_0025493 3300049581 Bacteria 5684
154 Ga0501070_0014795 3300049586 Bacteria 6566
155 Ga0501074_0002629 3300049590 Bacteria 12575
156 Ga0501223_007721 3300049663 Bacteria 2196
157 Ga0501259_000596 3300049688 Bacteria 5779
158 Ga0501219_000224 3300049703 Bacteria 10735
159 Ga0501225_0008684 3300049705 Bacteria 2909
160 Ga0501080_0093769 3300049742 Bacteria 2787
161 Ga0501083_0009661 3300049744 Bacteria 6815
162 Ga0501035_0079042 3300049822 Bacteria 2905
163 Ga0501044_0016339 3300049823 Bacteria 7968
164 Ga0501284_00060 3300050005 Bacteria 38817
165 nmdc:mga0k408_1537_c1 3300050493 Bacteria 12468
166 nmdc:mga0k408_2309_c1 3300050493 Bacteria 6233
167 Ga0500583_0002095 3300053092 Bacteria 5916
168 Ga0500608_001820 3300053122 Bacteria 7593
169 Ga0500622_0000219 3300053156 Bacteria 60477
170 Ga0500622_0003429 3300053156 Bacteria 10611
171 Ga0501082_0136794 3300060353 Bacteria 2126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0708671 Ga0436365_0708671_44_1366 435
2 3300009177 Ga0105248_10202039 Ga0105248_102020392 447
3 3300037312 Ga0395899_0000011 Ga0395899_0000011_258453_259862 467
4 3300025914 Ga0207671_10001014 Ga0207671_1000101427 477
5 3300044684 Ga0466966_0065118 Ga0466966_0065118_56_1735 493
6 3300046558 Ga0495633_0000004 Ga0495633_0000004_323108_324781 495
7 3300003323 rootH1_10049848 rootH1_100498484 497
8 3300042005 Ga0439448_0011069 Ga0439448_0011069_851_2515 503
9 3300009545 Ga0105237_10000271 Ga0105237_1000027127 507
10 3300005290 Ga0065712_10068858 Ga0065712_100688582 509
11 3300009093 Ga0105240_10094990 Ga0105240_100949903 509
12 3300028800 Ga0265338_10031073 Ga0265338_100310732 509
13 3300013104 Ga0157370_10013358 Ga0157370_100133585 510
14 3300025913 Ga0207695_10171056 Ga0207695_101710562 512
15 3300046454 Ga0495592_0044996 Ga0495592_0044996_1166_2824 514
16 3300046517 Ga0495630_0015501 Ga0495630_0015501_3113_4771 514
17 3300046536 Ga0495587_0028879 Ga0495587_0028879_873_2531 514
18 3300046642 Ga0495634_0102967 Ga0495634_0102967_122_1780 514
19 3300046511 Ga0495608_0033876 Ga0495608_0033876_1396_3054 515
20 3300010375 Ga0105239_10006242 Ga0105239_100062426 517
21 3300025913 Ga0207695_10000058 Ga0207695_10000058182 517
22 3300049663 Ga0501223_007721 Ga0501223_007721_416_1975 517
23 3300049705 Ga0501225_0008684 Ga0501225_0008684_752_2311 517
24 3300006358 Ga0068871_100011656 Ga0068871_1000116563 521
25 3300009176 Ga0105242_10002120 Ga0105242_100021203 521
26 3300014969 Ga0157376_10021988 Ga0157376_100219882 521
27 3300025250 Ga0209026_1000615 Ga0209026_10006158 521
28 3300025934 Ga0207686_10002594 Ga0207686_100025942 521
29 3300026088 Ga0207641_10015273 Ga0207641_100152734 521
30 3300047472 Ga0495686_0002568 Ga0495686_0002568_9437_11107 521
31 3300050493 nmdc:mga0k408_2309_c1 nmdc:mga0k408_2309_c1_2794_4464 521
32 3300013308 Ga0157375_10115111 Ga0157375_101151112 522
33 3300031730 Ga0307516_10074353 Ga0307516_100743533 522
34 3300049572 Ga0501036_0136001 Ga0501036_0136001_25_1692 522
35 3300006195 Ga0075366_10001297 Ga0075366_100012977 524
36 3300050493 nmdc:mga0k408_1537_c1 nmdc:mga0k408_1537_c1_824_2497 524
37 3300003316 rootH1_10101526 rootH1_101015263 526
38 3300031616 Ga0307508_10000327 Ga0307508_1000032732 526
39 3300049703 Ga0501219_000224 Ga0501219_000224_371_2035 526
40 3300050005 Ga0501284_00060 Ga0501284_00060_36979_38643 526
41 3300013104 Ga0157370_10038113 Ga0157370_100381133 528
42 3300003320 rootH2_10011933 rootH2_1001193357 530
43 3300002773 JGI25152J39213_1000208 JGI25152J39213_100020822 531
44 3300002774 JGI25150J39212_1000014 JGI25150J39212_1000014114 531
45 3300003187 JGI25151J46595_10000042 JGI25151J46595_10000042114 531
46 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009114 531
47 3300025245 Ga0207425_1000023 Ga0207425_1000023113 531
48 3300025258 Ga0209129_1000032 Ga0209129_1000032160 531
49 3300025294 Ga0209025_1000047 Ga0209025_1000047160 531
50 3300025297 Ga0209758_1000145 Ga0209758_1000145113 531
51 3300046507 Ga0495606_0025515 Ga0495606_0025515_305_1972 531
52 3300046512 Ga0495610_0000232 Ga0495610_0000232_25009_26673 531
53 3300013100 Ga0157373_10067335 Ga0157373_100673351 532
54 3300013104 Ga0157370_10013286 Ga0157370_100132867 532
55 3300013105 Ga0157369_10000031 Ga0157369_1000003180 532
56 3300015262 Ga0182007_10000002 Ga0182007_10000002111 532
57 3300017792 Ga0163161_10000500 Ga0163161_1000050018 532
58 3300037466 Ga0395898_0006028 Ga0395898_0006028_7476_9194 534
59 3300037471 Ga0395905_0000781 Ga0395905_0000781_16899_18617 534
60 iso_pu_bacteria 2738541284 2738764120 534
61 3300005288 Ga0065714_10002330 Ga0065714_1000233010 535
62 3300032004 Ga0307414_10112288 Ga0307414_101122882 535
63 3300049823 Ga0501044_0016339 Ga0501044_0016339_5284_7005 535
64 3300046524 Ga0495648_0003738 Ga0495648_0003738_1997_3670 536
65 3300049571 Ga0501034_0002888 Ga0501034_0002888_12480_14201 536
66 3300049575 Ga0501039_0066755 Ga0501039_0066755_387_2108 536
67 3300049579 Ga0501043_0004858 Ga0501043_0004858_2190_3911 536
68 3300049580 Ga0501046_0034770 Ga0501046_0034770_2131_3852 536
69 3300049581 Ga0501047_0025493 Ga0501047_0025493_1678_3399 536
70 3300049586 Ga0501070_0014795 Ga0501070_0014795_780_2501 536
71 3300049590 Ga0501074_0002629 Ga0501074_0002629_1216_2937 536
72 3300049742 Ga0501080_0093769 Ga0501080_0093769_974_2695 536
73 3300049744 Ga0501083_0009661 Ga0501083_0009661_2963_4684 536
74 3300049822 Ga0501035_0079042 Ga0501035_0079042_1103_2824 536
75 3300053092 Ga0500583_0002095 Ga0500583_0002095_3383_5056 536
76 3300053156 Ga0500622_0003429 Ga0500622_0003429_8011_9684 536
77 3300060353 Ga0501082_0136794 Ga0501082_0136794_390_2111 536
78 3300005455 Ga0070663_100009720 Ga0070663_1000097203 538
79 3300026067 Ga0207678_10016949 Ga0207678_100169493 538
80 3300049688 Ga0501259_000596 Ga0501259_000596_2814_4490 540
81 3300017792 Ga0163161_10000445 Ga0163161_1000044517 542
82 3300004799 Ga0058863_10047299 Ga0058863_100472995 543
83 3300004803 Ga0058862_10124592 Ga0058862_101245922 543
84 3300005336 Ga0070680_100016449 Ga0070680_1000164493 543
85 3300005530 Ga0070679_100017212 Ga0070679_1000172124 543
86 3300025913 Ga0207695_10137174 Ga0207695_101371742 543
87 3300025917 Ga0207660_10003963 Ga0207660_100039635 543
88 3300025921 Ga0207652_10007691 Ga0207652_100076912 543
89 iso_pu_bacteria 2895498888 2895500353 543
90 iso_pu_bacteria 2919186247 2919191263 543
91 iso_pu_bacteria 2939664404 2939669542 543
92 3300033180 Ga0307510_10004226 Ga0307510_100042269 544
93 iso_pu_bacteria 2738541283 2738758467 544
94 iso_pu_bacteria 2852627209 2852631827 544
95 3300009093 Ga0105240_10082467 Ga0105240_100824672 545
96 3300009174 Ga0105241_10004746 Ga0105241_100047463 545
97 3300009176 Ga0105242_10022848 Ga0105242_100228482 545
98 3300009545 Ga0105237_10001121 Ga0105237_100011216 545
99 3300009551 Ga0105238_10002992 Ga0105238_100029927 545
100 3300013296 Ga0157374_10000550 Ga0157374_100005508 545
101 3300042876 Ga0451577_0000185 Ga0451577_0000185_119925_121568 545
102 3300044673 Ga0453683_0000283 Ga0453683_0000283_54002_55645 545
103 3300044712 Ga0453684_0000602 Ga0453684_0000602_119925_121568 545
104 3300045051 Ga0451576_0000249 Ga0451576_0000249_119925_121568 545
105 iso_pu_bacteria 2902048731 2902051753 547
106 3300009545 Ga0105237_10003758 Ga0105237_100037584 548
107 3300013104 Ga0157370_10014387 Ga0157370_100143872 548
108 3300014497 Ga0182008_10000555 Ga0182008_1000055514 548
109 3300015261 Ga0182006_1003827 Ga0182006_10038273 548
110 3300017792 Ga0163161_10000900 Ga0163161_100009005 548
111 3300025914 Ga0207671_10003517 Ga0207671_100035174 548
112 3300028794 Ga0307515_10081404 Ga0307515_100814043 548
113 3300033180 Ga0307510_10044979 Ga0307510_100449792 548
114 3300046507 Ga0495606_0017873 Ga0495606_0017873_37_1704 548
115 3300047443 Ga0495687_000518 Ga0495687_000518_2475_4151 548
116 3300048925 Ga0496122_0000395 Ga0496122_0000395_41372_43024 548
117 3300048926 Ga0496123_0006024 Ga0496123_0006024_9457_11109 548
118 iso_pu_bacteria 2739367651 2739588240 548
119 iso_pu_bacteria 2739367663 2739648488 548
120 iso_pu_bacteria 2818991437 2819546208 548
121 3300053156 Ga0500622_0000219 Ga0500622_0000219_22113_23786 549
122 iso_pu_bacteria 2775506987 2776616501 549
123 3300031548 Ga0307408_100079494 Ga0307408_1000794942 550
124 3300005289 Ga0065704_10071739 Ga0065704_100717395 551
125 3300013102 Ga0157371_10002117 Ga0157371_100021177 551
126 3300003781 Ga0055536_1000019 Ga0055536_100001968 552
127 3300003791 Ga0055530_10004277 Ga0055530_100042773 552
128 3300005288 Ga0065714_10064590 Ga0065714_100645907 552
129 3300005563 Ga0068855_100191709 Ga0068855_1001917092 552
130 3300009093 Ga0105240_10165938 Ga0105240_101659382 552
131 3300013102 Ga0157371_10000220 Ga0157371_1000022017 552
132 3300013105 Ga0157369_10128229 Ga0157369_101282292 552
133 3300025292 Ga0209676_1000009 Ga0209676_1000009113 552
134 3300025298 Ga0209050_1000094 Ga0209050_1000094113 552
135 3300031548 Ga0307408_100001496 Ga0307408_1000014964 552
136 3300031548 Ga0307408_100002350 Ga0307408_1000023504 552
137 3300031731 Ga0307405_10000015 Ga0307405_1000001558 552
138 3300031911 Ga0307412_10000341 Ga0307412_1000034114 552
139 iso_pu_bacteria 2585427687 2586206245 552
140 iso_pu_bacteria 2849281842 2849282745 552
141 3300013104 Ga0157370_10072086 Ga0157370_100720862 553
142 3300013105 Ga0157369_10000507 Ga0157369_1000050713 553
143 3300013307 Ga0157372_10000048 Ga0157372_1000004851 553
144 3300037312 Ga0395899_0001558 Ga0395899_0001558_1089_2753 553
145 3300053122 Ga0500608_001820 Ga0500608_001820_443_2104 553
146 3300005339 Ga0070660_100035851 Ga0070660_1000358512 554
147 3300005355 Ga0070671_100002443 Ga0070671_1000024433 554
148 3300005457 Ga0070662_100000087 Ga0070662_10000008717 554
149 3300005548 Ga0070665_100000264 Ga0070665_10000026421 554
150 3300005563 Ga0068855_100114061 Ga0068855_1001140612 554
151 3300009093 Ga0105240_10011658 Ga0105240_100116584 554
152 3300009098 Ga0105245_10147694 Ga0105245_101476942 554
153 3300009174 Ga0105241_10000755 Ga0105241_1000075517 554
154 3300013296 Ga0157374_10003929 Ga0157374_100039295 554
155 3300013306 Ga0163162_10000008 Ga0163162_1000000875 554
156 3300013307 Ga0157372_10093431 Ga0157372_100934313 554
157 3300013307 Ga0157372_10105245 Ga0157372_101052453 554
158 3300025904 Ga0207647_10000416 Ga0207647_1000041612 554
159 3300025911 Ga0207654_10021279 Ga0207654_100212793 554
160 3300025913 Ga0207695_10016140 Ga0207695_100161408 554
161 3300025931 Ga0207644_10004341 Ga0207644_100043412 554
162 3300025933 Ga0207706_10000013 Ga0207706_1000001326 554
163 3300026035 Ga0207703_10122566 Ga0207703_101225662 554
164 3300028379 Ga0268266_10000268 Ga0268266_1000026821 554
165 3300046616 Ga0495668_0000011 Ga0495668_0000011_360302_361975 554
166 3300046660 Ga0495625_0002878 Ga0495625_0002878_14208_15881 554
167 3300049571 Ga0501034_0000004 Ga0501034_0000004_68249_69925 554
168 3300002077 JGI24744J21845_10002688 JGI24744J21845_100026882 555
169 3300005328 Ga0070676_10002056 Ga0070676_100020564 555
170 3300005459 Ga0068867_100003170 Ga0068867_1000031704 555
171 3300005539 Ga0068853_100008400 Ga0068853_1000084002 555
172 3300005616 Ga0068852_100006661 Ga0068852_1000066614 555
173 3300005718 Ga0068866_10007155 Ga0068866_100071553 555
174 3300006237 Ga0097621_100000140 Ga0097621_10000014033 555
175 3300006358 Ga0068871_100000195 Ga0068871_10000019531 555
176 3300006881 Ga0068865_100000060 Ga0068865_10000006031 555
177 3300025907 Ga0207645_10017251 Ga0207645_100172514 555
178 3300025924 Ga0207694_10002991 Ga0207694_100029918 555
179 3300025934 Ga0207686_10013671 Ga0207686_100136713 555
180 3300025938 Ga0207704_10000028 Ga0207704_1000002853 555
181 3300026041 Ga0207639_10008251 Ga0207639_100082513 555
182 3300026089 Ga0207648_10000173 Ga0207648_1000017310 555
183 3300026121 Ga0207683_10001258 Ga0207683_1000125810 555
184 3300026142 Ga0207698_10002495 Ga0207698_100024955 555

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10091

Glycoamylase

Putative glucoamylase

349

564

0.97

PF13205

Big_5

Bacterial Ig-like domain

45

166

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gl3-assembly1.cif.gz_A crystal structure of a putative glucoamylase (bacuni_03963) from bacteroides uniformis atcc 8492 at 2.01 a resolution 0.9799 149 555
5gzk-assembly2.cif.gz_B endo-beta-1,2-glucanase from chitinophaga pinensis - sophorotriose and glucose complex 0.9776 151 555
4qt9-assembly2.cif.gz_B crystal structure of a putative glucoamylase (baccac_03554) from bacteroides caccae atcc 43185 at 2.05 a resolution 0.9745 153 552
3eu8-assembly4.cif.gz_D crystal structure of putative glucoamylase (yp_210071.1) from bacteroides fragilis nctc 9343 at 2.12 a resolution 0.9704 148 552
4gl3-assembly1.cif.gz_A crystal structure of a putative glucoamylase (bacuni_03963) from bacteroides uniformis atcc 8492 at 2.01 a resolution 0.9658 149 555
ID Description Score Start End Superfamily
5gzhA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Glycoside hydrolase 144 (GH144) 0.9752 152 555 1.50.10.140
5gzhA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Glycoside hydrolase 144 (GH144) 0.9234 152 555 1.50.10.140
2c9rA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.768 36 141 2.60.40.1220
af_P76578_59_163_2.60.40.1220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7676 35 142 2.60.40.1220
af_P0AA57_27_124_2.60.40.1220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7627 38 141 2.60.40.1220
ID Description Score Start End GO Terms
AF-A0A4Q5YEK0-F1-model_v4 Beta-glucosidase 0.996 431 555
AF-A0A519ZP46-F1-model_v4 Beta-glucosidase 0.9951 415 555
AF-A0A3D6EWL2-F1-model_v4 Glycoamylase-like domain-containing protein 0.9941 400 551
AF-A0A7X7WQ73-F1-model_v4 DUF3131 domain-containing protein 0.9934 168 551
AF-A0A2J6H3K6-F1-model_v4 Beta-glucosidase 0.9927 215 555

Feature Viewer

pLDDT pTM Quality
91.26 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map