F282996

General Info

Members Datasets Scaffolds Average Seq Length
184 128 368 302

Family's Representative Sequence

Representative Sequence 3300042157|Ga0439458_0001397|Ga0439458_0001397_4938_5855
Length 305
Sequence MPRRELDYVLEKLDWMREQRIWPNGLRYLWTDAFGLVLYVSLFRETGEQRWLDAAKDLVVDVDCILGRPRGYRIGEAPDRDGQYFHYLAMWLFALACLGEHEPAYRGKGIQIAKGIHRPFVLPGHGVIWKMEEDLSAPYPGYGLGAMDAFDGYVSYKLLSETELAPEIAEMRAIMERQQLTIDQELGLGMMLWLAHFFPDEDWALVQREQSLAALDFLWTDPPGYFARASYARETRIAFANYGVSIGLQGQDVWPERVCALNDYFESHRSGDEYDREAITWVMACCSHFPGAFVSERVRGEAAPA

Samples

Sample ID Description Type Environment
1 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
53 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
54 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
90 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
93 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
94 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
95 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
96 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
97 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
98 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
99 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
100 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
101 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
102 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
103 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
104 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 2508501050 Microvirga lupini Lut6 Isolate Nodule
107 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
108 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
109 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
110 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
111 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
112 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
113 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
114 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
115 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
116 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
117 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
118 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
119 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
120 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
121 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
122 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
123 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
124 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
125 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
126 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
127 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
128 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 12.5
Rhizoplane 0.54
Rhizosphere 78.8
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439458_0001397 3300042157 Bacteria 6099
2 JGI24737J22298_10010491 3300001990 Bacteria 3057
3 JGI24737J22298_10024885 3300001990 Bacteria 1894
4 JGI24743J22301_10021909 3300001991 Bacteria 1222
5 rootH1_10117187 3300003316 Bacteria 1393
6 rootL2_10046714 3300003322 Bacteria 7019
7 Ga0055542_1002177 3300003762 Bacteria 7029
8 Ga0070658_10000606 3300005327 Bacteria 31075
9 Ga0070658_10141201 3300005327 Bacteria 2012
10 Ga0070670_100047008 3300005331 Bacteria 3713
11 Ga0070666_10117516 3300005335 Unclassified 1842
12 Ga0070680_100022394 3300005336 Bacteria 5033
13 Ga0070660_100000206 3300005339 Bacteria 39611
14 Ga0070669_100142070 3300005353 Bacteria 1852
15 Ga0070669_100157043 3300005353 Bacteria 1765
16 Ga0070671_100084298 3300005355 Bacteria 2658
17 Ga0070673_100035335 3300005364 Bacteria 3789
18 Ga0070659_100089177 3300005366 Bacteria 2470
19 Ga0070703_10073029 3300005406 Bacteria 1150
20 Ga0070662_100008146 3300005457 Bacteria 6828
21 Ga0070695_100110340 3300005545 Bacteria 1866
22 Ga0070704_100207580 3300005549 Bacteria 1585
23 Ga0068855_100000079 3300005563 Bacteria 117264
24 Ga0068857_100011184 3300005577 Bacteria 7805
25 Ga0068863_100003094 3300005841 Bacteria 16438
26 Ga0068862_100433934 3300005844 Bacteria 1235
27 Ga0081539_10013126 3300005985 Bacteria 6277
28 Ga0075366_10195400 3300006195 Bacteria 1230
29 Ga0075428_100055988 3300006844 Bacteria 4320
30 Ga0157371_10000261 3300013102 Bacteria 72525
31 Ga0157370_10058992 3300013104 Bacteria 3647
32 Ga0157372_10484195 3300013307 Bacteria 1442
33 Ga0163163_10279300 3300014325 Bacteria 1722
34 Ga0209148_1000146 3300025254 Bacteria 160734
35 Ga0207647_10028931 3300025904 Bacteria 3592
36 Ga0207647_10096043 3300025904 Bacteria 1764
37 Ga0207705_10000125 3300025909 Bacteria 84812
38 Ga0207660_10010178 3300025917 Bacteria 6094
39 Ga0207657_10000167 3300025919 Bacteria 67075
40 Ga0207681_10226240 3300025923 Bacteria 1450
41 Ga0207650_10265154 3300025925 Bacteria 1394
42 Ga0207644_10091612 3300025931 Bacteria 2267
43 Ga0207706_10038867 3300025933 Bacteria 4221
44 Ga0207667_10000957 3300025949 Bacteria 36826
45 Ga0207641_10075368 3300026088 Bacteria 2913
46 Ga0207676_10353759 3300026095 Bacteria 1359
47 Ga0207674_10000065 3300026116 Bacteria 109485
48 Ga0307410_10044507 3300031852 Bacteria 2949
49 Ga0307410_10224371 3300031852 Bacteria 1447
50 Ga0307406_10095887 3300031901 Bacteria 2008
51 Ga0307412_10042098 3300031911 Bacteria 2964
52 Ga0307412_10074978 3300031911 Bacteria 2319
53 Ga0307412_10188375 3300031911 Bacteria 1558
54 Ga0307409_100002252 3300031995 Bacteria 9977
55 Ga0307409_100171253 3300031995 Bacteria 1911
56 Ga0307416_100015749 3300032002 Bacteria 5232
57 Ga0307416_100022754 3300032002 Bacteria 4532
58 Ga0307416_100164453 3300032002 Bacteria 2056
59 Ga0307416_100224463 3300032002 Bacteria 1805
60 Ga0307414_10008528 3300032004 Bacteria 5819
61 Ga0307411_10083935 3300032005 Bacteria 2202
62 Ga0307415_100005058 3300032126 Bacteria 6942
63 Ga0307415_100141059 3300032126 Bacteria 1840
64 Ga0307415_100179406 3300032126 Bacteria 1660
65 Ga0373936_0038952 3300035113 Bacteria 1901
66 Ga0373939_0049525 3300035114 Bacteria 1299
67 Ga0373943_0001400 3300035170 Bacteria 10870
68 Ga0316574_0345555 3300035398 Unclassified 942
69 Ga0373931_0147080 3300035691 Bacteria 1370
70 Ga0373935_0006511 3300035692 Bacteria 6980
71 Ga0373927_0003997 3300035695 Bacteria 10433
72 Ga0373927_0224580 3300035695 Bacteria 1234
73 Ga0373947_0001347 3300035725 Bacteria 15095
74 Ga0373925_0002646 3300037068 Bacteria 14215
75 Ga0395899_0028040 3300037312 Bacteria 4241
76 Ga0395899_0145550 3300037312 Bacteria 1683
77 Ga0395899_0217975 3300037312 Bacteria 1323
78 Ga0395899_0356923 3300037312 Bacteria 976
79 Ga0395900_0002464 3300037418 Bacteria 20376
80 Ga0395900_0027587 3300037418 Bacteria 5816
81 Ga0395900_0039052 3300037418 Bacteria 4892
82 Ga0395900_0043982 3300037418 Bacteria 4603
83 Ga0395900_0047347 3300037418 Bacteria 4427
84 Ga0395900_0142785 3300037418 Bacteria 2450
85 Ga0395900_0152987 3300037418 Bacteria 2356
86 Ga0395900_0155716 3300037418 Bacteria 2333
87 Ga0395900_0223224 3300037418 Bacteria 1898
88 Ga0395900_0316642 3300037418 Bacteria 1542
89 Ga0395900_0363393 3300037418 Bacteria 1418
90 Ga0395898_0006331 3300037466 Bacteria 12650
91 Ga0395898_0019094 3300037466 Bacteria 6978
92 Ga0395898_0024038 3300037466 Bacteria 6149
93 Ga0395898_0049695 3300037466 Bacteria 4108
94 Ga0395898_0073466 3300037466 Bacteria 3304
95 Ga0395898_0187308 3300037466 Bacteria 1977
96 Ga0395905_0000533 3300037471 Bacteria 52133
97 Ga0395905_0001585 3300037471 Bacteria 27082
98 Ga0395905_0003180 3300037471 Bacteria 17680
99 Ga0395905_0006239 3300037471 Bacteria 12037
100 Ga0395905_0014002 3300037471 Bacteria 7672
101 Ga0395905_0025177 3300037471 Bacteria 5612
102 Ga0395905_0027479 3300037471 Bacteria 5366
103 Ga0395905_0050441 3300037471 Bacteria 3898
104 Ga0395905_0062359 3300037471 Bacteria 3487
105 Ga0395905_0086137 3300037471 Bacteria 2944
106 Ga0395905_0123480 3300037471 Bacteria 2434
107 Ga0395905_0138511 3300037471 Bacteria 2289
108 Ga0395905_0319680 3300037471 Bacteria 1442
109 Ga0395905_0490382 3300037471 Bacteria 1128
110 Ga0395905_0523391 3300037471 Bacteria 1086
111 Ga0395901_0011606 3300038443 Bacteria 8926
112 Ga0395901_0029537 3300038443 Bacteria 5645
113 Ga0395901_0043557 3300038443 Bacteria 4655
114 Ga0395901_0062247 3300038443 Bacteria 3883
115 Ga0395901_0078923 3300038443 Bacteria 3437
116 Ga0395901_0623045 3300038443 Bacteria 1085
117 Ga0439448_0001631 3300042005 Bacteria 5878
118 Ga0439458_0000036 3300042157 Bacteria 21009
119 Ga0451577_0010608 3300042876 Bacteria 8786
120 Ga0451577_0051169 3300042876 Bacteria 3688
121 Ga0451577_0414525 3300042876 Bacteria 1223
122 Ga0466963_0197598 3300044694 Bacteria 1406
123 Ga0453684_0001067 3300044712 Bacteria 87208
124 Ga0466968_0003495 3300044735 Bacteria 5810
125 Ga0466970_0001478 3300044765 Bacteria 11349
126 Ga0466958_0008823 3300045836 Bacteria 5601
127 Ga0466967_0018965 3300045976 Bacteria 5518
128 Ga0466967_0282266 3300045976 Bacteria 1593
129 Ga0495629_0041724 3300046459 Bacteria 3227
130 Ga0495630_0024263 3300046517 Bacteria 4485
131 Ga0495654_0112037 3300046530 Bacteria 1244
132 Ga0495640_0181873 3300046533 Bacteria 1339
133 Ga0495597_0000444 3300046542 Bacteria 35383
134 Ga0495625_0000221 3300046660 Bacteria 90175
135 Ga0495669_0031673 3300046684 Bacteria 2322
136 Ga0495613_0086473 3300046689 Bacteria 2273
137 Ga0495624_0002625 3300046690 Bacteria 13571
138 Ga0495676_0034449 3300047321 Bacteria 4249
139 Ga0495593_0024558 3300047673 Bacteria 3340
140 Ga0495593_0127477 3300047673 Bacteria 1293
141 Ga0496102_0435576 3300048905 Bacteria 1230
142 Ga0495682_0019634 3300049460 Bacteria 2541
143 Ga0501031_0255528 3300049568 Bacteria 1139
144 Ga0501071_0420884 3300049587 Bacteria 1021
145 Ga0501257_000440 3300049686 Bacteria 8194
146 Ga0501221_017558 3300049704 Bacteria 1368
147 nmdc:mga0rr50_101819_c1 3300050513 Unclassified 2258
148 Ga0495601_0010213 3300053077 Bacteria 5581
149 Ga0495612_0105816 3300053078 Unclassified 1201
150 Ga0495619_0218697 3300053085 Bacteria 1319
151 Ga0500651_0022172 3300053093 Bacteria 3967
152 Ga0500569_001658 3300053109 Bacteria 4243
153 Ga0500608_000575 3300053122 Bacteria 13583
154 Ga0500614_011136 3300053123 Bacteria 1942
155 Ga0500658_0040020 3300053134 Bacteria 1876
156 Ga0500559_0004015 3300053136 Bacteria 7068
157 Ga0500590_103170 3300053148 Bacteria 1366
158 Ga0500636_0085340 3300053177 Bacteria 1814
159 Ga0500637_0178221 3300053178 Bacteria 1219
160 Ga0500645_076223 3300053730 Bacteria 959
161 Ga0501084_0325058 3300054114 Bacteria 1299
162 2508727490 2508501050 Bacteria 9633614
163 2517411280 2517287029 Bacteria 6905599
164 2856346336 2856342000 Bacteria 7176905
165 2871477354 2871474448 Bacteria 6806570
166 2878792623 2878788777 Bacteria 6567085
167 2935789475 2935785616 Bacteria 7962367
168 2935797482 2935793552 Bacteria 8012592
169 2937838397 2937836603 Bacteria 6811263
170 2958074745 2958071322 Bacteria 6815895
171 643599788 643348564 Bacteria 8839022
172 8004640094 8004633249 Bacteria 6723080
173 8016524221 8016522445 Bacteria 8156687
174 8016537769 8016530956 Bacteria 8155261
175 8016542050 8016539877 Bacteria 8155419
176 8016551233 8016548790 Bacteria 8155074
177 8016567427 8016566248 Bacteria 8158151
178 8016580134 8016575299 Bacteria 8154085
179 8016597566 8016595262 Bacteria 8149947
180 8016629739 8016622563 Bacteria 7999408
181 8019537442 8019530166 Bacteria 8155624
182 8019539153 8019538911 Bacteria 7872763
183 8019548678 8019547302 Bacteria 7996444
184 8055623120 8055617313 Bacteria 7548464
185 Ga0439458_0001397
186 JGI24737J22298_10010491
187 JGI24737J22298_10024885
188 JGI24743J22301_10021909
189 rootH1_10117187
190 rootL2_10046714
191 Ga0055542_1002177
192 Ga0070658_10000606
193 Ga0070658_10141201
194 Ga0070670_100047008
195 Ga0070666_10117516
196 Ga0070680_100022394
197 Ga0070660_100000206
198 Ga0070669_100142070
199 Ga0070669_100157043
200 Ga0070671_100084298
201 Ga0070673_100035335
202 Ga0070659_100089177
203 Ga0070703_10073029
204 Ga0070662_100008146
205 Ga0070695_100110340
206 Ga0070704_100207580
207 Ga0068855_100000079
208 Ga0068857_100011184
209 Ga0068863_100003094
210 Ga0068862_100433934
211 Ga0081539_10013126
212 Ga0075366_10195400
213 Ga0075428_100055988
214 Ga0157371_10000261
215 Ga0157370_10058992
216 Ga0157372_10484195
217 Ga0163163_10279300
218 Ga0209148_1000146
219 Ga0207647_10028931
220 Ga0207647_10096043
221 Ga0207705_10000125
222 Ga0207660_10010178
223 Ga0207657_10000167
224 Ga0207681_10226240
225 Ga0207650_10265154
226 Ga0207644_10091612
227 Ga0207706_10038867
228 Ga0207667_10000957
229 Ga0207641_10075368
230 Ga0207676_10353759
231 Ga0207674_10000065
232 Ga0307410_10044507
233 Ga0307410_10224371
234 Ga0307406_10095887
235 Ga0307412_10042098
236 Ga0307412_10074978
237 Ga0307412_10188375
238 Ga0307409_100002252
239 Ga0307409_100171253
240 Ga0307416_100015749
241 Ga0307416_100022754
242 Ga0307416_100164453
243 Ga0307416_100224463
244 Ga0307414_10008528
245 Ga0307411_10083935
246 Ga0307415_100005058
247 Ga0307415_100141059
248 Ga0307415_100179406
249 Ga0373936_0038952
250 Ga0373939_0049525
251 Ga0373943_0001400
252 Ga0316574_0345555
253 Ga0373931_0147080
254 Ga0373935_0006511
255 Ga0373927_0003997
256 Ga0373927_0224580
257 Ga0373947_0001347
258 Ga0373925_0002646
259 Ga0395899_0028040
260 Ga0395899_0145550
261 Ga0395899_0217975
262 Ga0395899_0356923
263 Ga0395900_0002464
264 Ga0395900_0027587
265 Ga0395900_0039052
266 Ga0395900_0043982
267 Ga0395900_0047347
268 Ga0395900_0142785
269 Ga0395900_0152987
270 Ga0395900_0155716
271 Ga0395900_0223224
272 Ga0395900_0316642
273 Ga0395900_0363393
274 Ga0395898_0006331
275 Ga0395898_0019094
276 Ga0395898_0024038
277 Ga0395898_0049695
278 Ga0395898_0073466
279 Ga0395898_0187308
280 Ga0395905_0000533
281 Ga0395905_0001585
282 Ga0395905_0003180
283 Ga0395905_0006239
284 Ga0395905_0014002
285 Ga0395905_0025177
286 Ga0395905_0027479
287 Ga0395905_0050441
288 Ga0395905_0062359
289 Ga0395905_0086137
290 Ga0395905_0123480
291 Ga0395905_0138511
292 Ga0395905_0319680
293 Ga0395905_0490382
294 Ga0395905_0523391
295 Ga0395901_0011606
296 Ga0395901_0029537
297 Ga0395901_0043557
298 Ga0395901_0062247
299 Ga0395901_0078923
300 Ga0395901_0623045
301 Ga0439448_0001631
302 Ga0439458_0000036
303 Ga0451577_0010608
304 Ga0451577_0051169
305 Ga0451577_0414525
306 Ga0466963_0197598
307 Ga0453684_0001067
308 Ga0466968_0003495
309 Ga0466970_0001478
310 Ga0466958_0008823
311 Ga0466967_0018965
312 Ga0466967_0282266
313 Ga0495629_0041724
314 Ga0495630_0024263
315 Ga0495654_0112037
316 Ga0495640_0181873
317 Ga0495597_0000444
318 Ga0495625_0000221
319 Ga0495669_0031673
320 Ga0495613_0086473
321 Ga0495624_0002625
322 Ga0495676_0034449
323 Ga0495593_0024558
324 Ga0495593_0127477
325 Ga0496102_0435576
326 Ga0495682_0019634
327 Ga0501031_0255528
328 Ga0501071_0420884
329 Ga0501257_000440
330 Ga0501221_017558
331 nmdc:mga0rr50_101819_c1
332 Ga0495601_0010213
333 Ga0495612_0105816
334 Ga0495619_0218697
335 Ga0500651_0022172
336 Ga0500569_001658
337 Ga0500608_000575
338 Ga0500614_011136
339 Ga0500658_0040020
340 Ga0500559_0004015
341 Ga0500590_103170
342 Ga0500636_0085340
343 Ga0500637_0178221
344 Ga0500645_076223
345 Ga0501084_0325058
346 2508727490
347 2517411280
348 2856346336
349 2871477354
350 2878792623
351 2935789475
352 2935797482
353 2937838397
354 2958074745
355 643599788
356 8004640094
357 8016524221
358 8016537769
359 8016542050
360 8016551233
361 8016567427
362 8016580134
363 8016597566
364 8016629739
365 8019537442
366 8019539153
367 8019548678
368 8055623120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhb-assembly1.cif.gz_A structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167 0.7368 26 291
5zhb-assembly2.cif.gz_B structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167 0.7331 26 291
4v1s-assembly1.cif.gz_A structure of the gh76 alpha-mannanase bt2949 from bacteroides thetaiotaomicron 0.7032 5 292
3k7x-assembly1.cif.gz_A crystal structure of the lin0763 protein from listeria innocua. northeast structural genomics consortium target lkr23. 0.7024 24 290
6shd-assembly3.cif.gz_C structure of the gh76a alpha-1,6-mannanase from salegentibacter sp. hel1_6 0.6884 22 290
ID Description Score Start End Superfamily
3k7xA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7116 24 290 1.50.10.20
af_Q9P6I3_27_384_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7022 7 290 1.50.10.20
4z4lA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6821 26 289 1.50.10.10
4c1sB00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6739 22 291 1.50.10.20
5x32B00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6662 22 290 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A528B449-F1-model_v4 Uncharacterized protein 0.991 147 297
AF-A0A6N0E358-F1-model_v4 DUF2264 domain-containing protein 0.9869 5 298 GO:0005975
AF-A0A528B449-F1-model_v4 Uncharacterized protein 0.9846 147 297
AF-V7FFT1-F1-model_v4 Uncharacterized protein 0.9802 5 303 GO:0005975
AF-A0A6N0E358-F1-model_v4 DUF2264 domain-containing protein 0.9672 5 298 GO:0005975

Map