F282710

General Info

Members Datasets Scaffolds Average Seq Length
184 101 368 160

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10092720|Ga0207665_100927203
Length 185
Sequence VDSEIGDRSPHLKMIIGIVAVDQNLAIGKGGRLPWHYSADMKFFKQRTIGNAVVMGRRTWLTLKGPLKDRENIVLSRDQKLPKQDSLIVLRDVDAVLNLLGDRDIHLFVIGGAQVYESFLPRIQRWIVSEIPVAVEAADTFMPANFLDGFEMYELRQLDEGLRVKFYERKSASVSEARREGGPDG

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10092720 3300025939 Bacteria 2096
2 Ga0065707_10103850 3300005295 Bacteria 2726
3 Ga0070670_100000755 3300005331 Bacteria 25080
4 Ga0070670_100142891 3300005331 Bacteria 2070
5 Ga0068869_100001234 3300005334 Bacteria 15080
6 Ga0068869_100152094 3300005334 Bacteria 1795
7 Ga0068869_100817024 3300005334 Bacteria 802
8 Ga0070680_100534625 3300005336 Bacteria 1004
9 Ga0070689_101020912 3300005340 Unclassified 736
10 Ga0070687_100893963 3300005343 Bacteria 636
11 Ga0070692_10706108 3300005345 Bacteria 679
12 Ga0070669_100000797 3300005353 Bacteria 22892
13 Ga0070703_10230212 3300005406 Bacteria 742
14 Ga0070701_10016544 3300005438 Bacteria 3432
15 Ga0070705_100172197 3300005440 Bacteria 1458
16 Ga0070700_100036122 3300005441 Bacteria 2995
17 Ga0070700_100135111 3300005441 Bacteria 1669
18 Ga0070694_100268633 3300005444 Bacteria 1296
19 Ga0070694_100272549 3300005444 Bacteria 1287
20 Ga0070708_100004095 3300005445 Bacteria 11453
21 Ga0070708_100386908 3300005445 Bacteria 1319
22 Ga0070708_100476826 3300005445 Bacteria 1177
23 Ga0070706_100009563 3300005467 Bacteria 9016
24 Ga0070706_100025485 3300005467 Bacteria 5443
25 Ga0070706_100050058 3300005467 Bacteria 3855
26 Ga0070706_100085350 3300005467 Bacteria 2925
27 Ga0070707_100000089 3300005468 Bacteria 82091
28 Ga0070707_100070394 3300005468 Bacteria 3369
29 Ga0070707_100076389 3300005468 Bacteria 3231
30 Ga0070698_100003125 3300005471 Bacteria 18241
31 Ga0070698_100009377 3300005471 Bacteria 10498
32 Ga0070698_100016935 3300005471 Bacteria 7684
33 Ga0070698_100024807 3300005471 Bacteria 6252
34 Ga0070699_100011587 3300005518 Bacteria 7612
35 Ga0070699_100013876 3300005518 Bacteria 6930
36 Ga0070699_100161147 3300005518 Bacteria 1985
37 Ga0070699_100170486 3300005518 Bacteria 1928
38 Ga0070699_100214140 3300005518 Bacteria 1716
39 Ga0070697_100000461 3300005536 Bacteria 31165
40 Ga0070697_100005034 3300005536 Bacteria 10145
41 Ga0070697_101196568 3300005536 Bacteria 677
42 Ga0070686_100161243 3300005544 Bacteria 1579
43 Ga0070686_100370358 3300005544 Bacteria 1081
44 Ga0070686_100429709 3300005544 Bacteria 1011
45 Ga0070686_100587254 3300005544 Bacteria 876
46 Ga0070695_100026063 3300005545 Bacteria 3614
47 Ga0070696_100099005 3300005546 Bacteria 2086
48 Ga0070704_100025408 3300005549 Bacteria 3899
49 Ga0070704_100380766 3300005549 Bacteria 1199
50 Ga0070704_100557943 3300005549 Bacteria 1002
51 Ga0070704_101337648 3300005549 Bacteria 656
52 Ga0068857_100286101 3300005577 Bacteria 1517
53 Ga0068854_100768477 3300005578 Bacteria 837
54 Ga0070702_100238986 3300005615 Bacteria 1225
55 Ga0070702_101271798 3300005615 Bacteria 596
56 Ga0068859_100438705 3300005617 Bacteria 1402
57 Ga0068859_100859021 3300005617 Unclassified 993
58 Ga0068859_101386966 3300005617 Bacteria 775
59 Ga0068859_102275562 3300005617 Bacteria 598
60 Ga0068864_100024267 3300005618 Bacteria 5100
61 Ga0068861_101738342 3300005719 Bacteria 617
62 Ga0068870_10417776 3300005840 Bacteria 877
63 Ga0068863_100083015 3300005841 Bacteria 3036
64 Ga0068858_100015494 3300005842 Bacteria 7170
65 Ga0068860_100342290 3300005843 Bacteria 1470
66 Ga0081540_1068819 3300005983 Bacteria 1648
67 Ga0070715_10000017 3300006163 Bacteria 132686
68 Ga0070716_100000002 3300006173 Bacteria 396037
69 Ga0075433_10247510 3300006852 Bacteria 1582
70 Ga0075433_10902793 3300006852 Bacteria 771
71 Ga0075433_11042826 3300006852 Unclassified 712
72 Ga0075434_101600749 3300006871 Bacteria 660
73 Ga0097620_100438726 3300006931 Bacteria 1402
74 Ga0097620_100858983 3300006931 Unclassified 993
75 Ga0097620_101387468 3300006931 Bacteria 775
76 Ga0097620_102276170 3300006931 Bacteria 598
77 Ga0075435_100784613 3300007076 Bacteria 829
78 Ga0099794_10153212 3300007265 Bacteria 1170
79 Ga0105240_10885916 3300009093 Bacteria 961
80 Ga0105245_10545132 3300009098 Bacteria 1181
81 Ga0105245_10873326 3300009098 Bacteria 940
82 Ga0114129_10013961 3300009147 Bacteria 11445
83 Ga0114129_10052183 3300009147 Bacteria 5739
84 Ga0114129_11949257 3300009147 Bacteria 711
85 Ga0105243_10149119 3300009148 Bacteria 2004
86 Ga0105243_10150719 3300009148 Bacteria 1994
87 Ga0105243_10492402 3300009148 Bacteria 1160
88 Ga0105243_10677247 3300009148 Bacteria 1003
89 Ga0105243_10879731 3300009148 Unclassified 889
90 Ga0105241_10134662 3300009174 Bacteria 2004
91 Ga0105242_10302389 3300009176 Bacteria 1461
92 Ga0105242_11356371 3300009176 Bacteria 737
93 Ga0105242_11530694 3300009176 Bacteria 699
94 Ga0105248_10438235 3300009177 Bacteria 1472
95 Ga0105249_10097582 3300009553 Bacteria 2759
96 Ga0105249_10422688 3300009553 Bacteria 1367
97 Ga0105246_10124990 3300011119 Bacteria 1912
98 Ga0105246_11540524 3300011119 Bacteria 626
99 Ga0157378_10000359 3300013297 Bacteria 44901
100 Ga0157378_10191857 3300013297 Bacteria 1927
101 Ga0157378_10329712 3300013297 Bacteria 1485
102 Ga0157378_10404367 3300013297 Bacteria 1346
103 Ga0157378_10486156 3300013297 Bacteria 1231
104 Ga0157378_11142371 3300013297 Unclassified 817
105 Ga0163162_10042359 3300013306 Bacteria 4557
106 Ga0157375_10299452 3300013308 Bacteria 1772
107 Ga0157375_10686167 3300013308 Bacteria 1178
108 Ga0157375_11953873 3300013308 Unclassified 697
109 Ga0163163_10518206 3300014325 Bacteria 1254
110 Ga0163163_10802679 3300014325 Unclassified 1005
111 Ga0163163_11150616 3300014325 Bacteria 839
112 Ga0157380_10000104 3300014326 Bacteria 46962
113 Ga0157380_10621979 3300014326 Bacteria 1072
114 Ga0157379_10159684 3300014968 Bacteria 2035
115 Ga0157376_10696435 3300014969 Bacteria 1021
116 Ga0207685_10000017 3300025905 Bacteria 146902
117 Ga0207643_10120712 3300025908 Bacteria 1552
118 Ga0207684_10018688 3300025910 Bacteria 5932
119 Ga0207684_10022415 3300025910 Bacteria 5390
120 Ga0207684_10035873 3300025910 Bacteria 4209
121 Ga0207684_10805025 3300025910 Bacteria 794
122 Ga0207684_10962410 3300025910 Bacteria 716
123 Ga0207654_10195983 3300025911 Bacteria 1327
124 Ga0207707_10000022 3300025912 Bacteria 198808
125 Ga0207660_10001872 3300025917 Bacteria 14026
126 Ga0207662_10826292 3300025918 Bacteria 654
127 Ga0207652_10001213 3300025921 Bacteria 23128
128 Ga0207646_10000703 3300025922 Bacteria 43382
129 Ga0207646_10010309 3300025922 Bacteria 9141
130 Ga0207646_10069630 3300025922 Bacteria 3142
131 Ga0207646_10072772 3300025922 Bacteria 3070
132 Ga0207646_10905550 3300025922 Bacteria 782
133 Ga0207646_11018267 3300025922 Bacteria 731
134 Ga0207650_10000746 3300025925 Bacteria 25100
135 Ga0207650_10186678 3300025925 Unclassified 1655
136 Ga0207687_10486615 3300025927 Bacteria 1028
137 Ga0207644_11170218 3300025931 Bacteria 646
138 Ga0207706_10392040 3300025933 Bacteria 1204
139 Ga0207686_10383297 3300025934 Bacteria 1067
140 Ga0207709_10184490 3300025935 Bacteria 1476
141 Ga0207709_10474327 3300025935 Bacteria 972
142 Ga0207665_10000004 3300025939 Bacteria 218220
143 Ga0207711_10785382 3300025941 Bacteria 887
144 Ga0207689_10002343 3300025942 Bacteria 17709
145 Ga0207689_10047174 3300025942 Bacteria 3559
146 Ga0207689_10682698 3300025942 Bacteria 866
147 Ga0207651_10068174 3300025960 Bacteria 2507
148 Ga0207651_10512701 3300025960 Bacteria 1038
149 Ga0207712_11204044 3300025961 Bacteria 676
150 Ga0207703_10164639 3300026035 Bacteria 1945
151 Ga0207708_10063754 3300026075 Bacteria 2815
152 Ga0207708_10697411 3300026075 Bacteria 868
153 Ga0207708_11334659 3300026075 Bacteria 629
154 Ga0207641_10092928 3300026088 Bacteria 2643
155 Ga0207676_10688167 3300026095 Bacteria 990
156 Ga0207676_10962156 3300026095 Bacteria 840
157 Ga0207676_11427473 3300026095 Bacteria 688
158 Ga0207674_10386784 3300026116 Bacteria 1352
159 Ga0207675_101286041 3300026118 Bacteria 752
160 Ga0207683_11460575 3300026121 Bacteria 632
161 Ga0209588_1046885 3300027671 Bacteria 1398
162 Ga0268264_10254356 3300028381 Bacteria 1633
163 Ga0307416_100048682 3300032002 Bacteria 3365
164 Ga0373937_0140667 3300036401 Bacteria 2258
165 Ga0395901_0664448 3300038443 Bacteria 1044
166 Ga0450891_017634 3300042129 Bacteria 687
167 Ga0439464_0016999 3300042439 Bacteria 1970
168 Ga0453683_0110542 3300044673 Bacteria 1728
169 Ga0495620_0248461 3300046515 Bacteria 678
170 Ga0495663_0000446 3300046525 Bacteria 15088
171 Ga0495598_0000302 3300046537 Bacteria 8851
172 Ga0495621_0000043 3300046539 Bacteria 24838
173 Ga0495621_0029878 3300046539 Unclassified 1860
174 Ga0495636_0019657 3300047318 Bacteria 2717
175 nmdc:mga05p37_1392066_c1 3300050507 Bacteria 707
176 nmdc:mga05p37_68374_c1 3300050507 Bacteria 4368
177 nmdc:mga05p37_70050_c1 3300050507 Bacteria 4314
178 nmdc:mga09592_175915_c1 3300050508 Bacteria 1851
179 nmdc:mga0rr50_174106_c1 3300050513 Bacteria 1755
180 nmdc:mga0rr50_708220_c1 3300050513 Bacteria 859
181 nmdc:mga0a205_314646_c1 3300050515 Bacteria 1437
182 nmdc:mga0a205_387101_c1 3300050515 Bacteria 1263
183 nmdc:mga0a205_538188_c1 3300050515 Bacteria 1024
184 nmdc:mga0a205_737238_c1 3300050515 Bacteria 834
185 Ga0207665_10092720
186 Ga0065707_10103850
187 Ga0070670_100000755
188 Ga0070670_100142891
189 Ga0068869_100001234
190 Ga0068869_100152094
191 Ga0068869_100817024
192 Ga0070680_100534625
193 Ga0070689_101020912
194 Ga0070687_100893963
195 Ga0070692_10706108
196 Ga0070669_100000797
197 Ga0070703_10230212
198 Ga0070701_10016544
199 Ga0070705_100172197
200 Ga0070700_100036122
201 Ga0070700_100135111
202 Ga0070694_100268633
203 Ga0070694_100272549
204 Ga0070708_100004095
205 Ga0070708_100386908
206 Ga0070708_100476826
207 Ga0070706_100009563
208 Ga0070706_100025485
209 Ga0070706_100050058
210 Ga0070706_100085350
211 Ga0070707_100000089
212 Ga0070707_100070394
213 Ga0070707_100076389
214 Ga0070698_100003125
215 Ga0070698_100009377
216 Ga0070698_100016935
217 Ga0070698_100024807
218 Ga0070699_100011587
219 Ga0070699_100013876
220 Ga0070699_100161147
221 Ga0070699_100170486
222 Ga0070699_100214140
223 Ga0070697_100000461
224 Ga0070697_100005034
225 Ga0070697_101196568
226 Ga0070686_100161243
227 Ga0070686_100370358
228 Ga0070686_100429709
229 Ga0070686_100587254
230 Ga0070695_100026063
231 Ga0070696_100099005
232 Ga0070704_100025408
233 Ga0070704_100380766
234 Ga0070704_100557943
235 Ga0070704_101337648
236 Ga0068857_100286101
237 Ga0068854_100768477
238 Ga0070702_100238986
239 Ga0070702_101271798
240 Ga0068859_100438705
241 Ga0068859_100859021
242 Ga0068859_101386966
243 Ga0068859_102275562
244 Ga0068864_100024267
245 Ga0068861_101738342
246 Ga0068870_10417776
247 Ga0068863_100083015
248 Ga0068858_100015494
249 Ga0068860_100342290
250 Ga0081540_1068819
251 Ga0070715_10000017
252 Ga0070716_100000002
253 Ga0075433_10247510
254 Ga0075433_10902793
255 Ga0075433_11042826
256 Ga0075434_101600749
257 Ga0097620_100438726
258 Ga0097620_100858983
259 Ga0097620_101387468
260 Ga0097620_102276170
261 Ga0075435_100784613
262 Ga0099794_10153212
263 Ga0105240_10885916
264 Ga0105245_10545132
265 Ga0105245_10873326
266 Ga0114129_10013961
267 Ga0114129_10052183
268 Ga0114129_11949257
269 Ga0105243_10149119
270 Ga0105243_10150719
271 Ga0105243_10492402
272 Ga0105243_10677247
273 Ga0105243_10879731
274 Ga0105241_10134662
275 Ga0105242_10302389
276 Ga0105242_11356371
277 Ga0105242_11530694
278 Ga0105248_10438235
279 Ga0105249_10097582
280 Ga0105249_10422688
281 Ga0105246_10124990
282 Ga0105246_11540524
283 Ga0157378_10000359
284 Ga0157378_10191857
285 Ga0157378_10329712
286 Ga0157378_10404367
287 Ga0157378_10486156
288 Ga0157378_11142371
289 Ga0163162_10042359
290 Ga0157375_10299452
291 Ga0157375_10686167
292 Ga0157375_11953873
293 Ga0163163_10518206
294 Ga0163163_10802679
295 Ga0163163_11150616
296 Ga0157380_10000104
297 Ga0157380_10621979
298 Ga0157379_10159684
299 Ga0157376_10696435
300 Ga0207685_10000017
301 Ga0207643_10120712
302 Ga0207684_10018688
303 Ga0207684_10022415
304 Ga0207684_10035873
305 Ga0207684_10805025
306 Ga0207684_10962410
307 Ga0207654_10195983
308 Ga0207707_10000022
309 Ga0207660_10001872
310 Ga0207662_10826292
311 Ga0207652_10001213
312 Ga0207646_10000703
313 Ga0207646_10010309
314 Ga0207646_10069630
315 Ga0207646_10072772
316 Ga0207646_10905550
317 Ga0207646_11018267
318 Ga0207650_10000746
319 Ga0207650_10186678
320 Ga0207687_10486615
321 Ga0207644_11170218
322 Ga0207706_10392040
323 Ga0207686_10383297
324 Ga0207709_10184490
325 Ga0207709_10474327
326 Ga0207665_10000004
327 Ga0207711_10785382
328 Ga0207689_10002343
329 Ga0207689_10047174
330 Ga0207689_10682698
331 Ga0207651_10068174
332 Ga0207651_10512701
333 Ga0207712_11204044
334 Ga0207703_10164639
335 Ga0207708_10063754
336 Ga0207708_10697411
337 Ga0207708_11334659
338 Ga0207641_10092928
339 Ga0207676_10688167
340 Ga0207676_10962156
341 Ga0207676_11427473
342 Ga0207674_10386784
343 Ga0207675_101286041
344 Ga0207683_11460575
345 Ga0209588_1046885
346 Ga0268264_10254356
347 Ga0307416_100048682
348 Ga0373937_0140667
349 Ga0395901_0664448
350 Ga0450891_017634
351 Ga0439464_0016999
352 Ga0453683_0110542
353 Ga0495620_0248461
354 Ga0495663_0000446
355 Ga0495598_0000302
356 Ga0495621_0000043
357 Ga0495621_0029878
358 Ga0495636_0019657
359 nmdc:mga05p37_1392066_c1
360 nmdc:mga05p37_68374_c1
361 nmdc:mga05p37_70050_c1
362 nmdc:mga09592_175915_c1
363 nmdc:mga0rr50_174106_c1
364 nmdc:mga0rr50_708220_c1
365 nmdc:mga0a205_314646_c1
366 nmdc:mga0a205_387101_c1
367 nmdc:mga0a205_538188_c1
368 nmdc:mga0a205_737238_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

14

169

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfr-assembly1.cif.gz_A crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate 0.916 3 157
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.91 1 153
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9013 1 156
5ecx-assembly1.cif.gz_B klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine 0.901 2 157
3tq8-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim 0.8999 1 157
ID Description Score Start End Superfamily
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9048 2 157 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9013 1 156 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.901 2 157 3.40.430.10
4m7vA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8969 1 157 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8939 2 157 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2V8QDB3-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.98 34 156 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WUG3-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9758 1 157 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WN40-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9707 2 156 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WUG3-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9697 1 157 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7V9Q7G2-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9695 2 157 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map