F282471

General Info

Members Datasets Scaffolds Average Seq Length
184 99 366 659

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10058516|Ga0105245_100585162
Length 697
Sequence MNVRGRPSTNQTDVGDQEAAHAIRCFRQIKVKVLYMIRRHALVVIIAIAFLFAPQGSALAQNTLPTAAKPLPLLSPIFGDNMVLQRGKVNTIWGWSDPGDKVWVEIAGKPAFGIAGADRRWQVKIQPPPAGGPYTVEIRGXXXXELHNVLVGDVWLCGGQSNMQVGLARARNGDEEVKDANNPEIRFFSVAAHSAYHHTDLAEGVWKVVTPATAEQVSAVAYYFARKIQQQIHVPIGLVVDALGGTPAEAWTSAEALRPLKDFDVPLGELQKLAAAGAPEYGNYVMHWYDQYDIGLKGNWTAPDVDDSTWKVVNIPGGFSELGVPDAPALVWFKREVVLSDPLPAGRASIHLGSIERMDTVYVNGAQVGASAWVENPRVYAVPDGVLNPGKNVLTIRVLKTKPQGGFLGKPEELHLTLGDKTAIPLAGEWKGQLSLDARPPHPLPIGYENWPVMPSVLYEGMLAPIAPLSITGALWYQGEQNSDRGFQYRKILPVMIADWRKLFGQGDFPFYIVSLPAFQHRRDTPSDDTWAETRESQAIAAASVRNSCLAVTIDTGDPDNIHPKDKQPVGERLAFCALAKHYGKKIPYSGPTLASVKRLPGSVRIRFKHTDRGLVAKGGTLAEFEIAGEDRKWYWADARIEGRTVVVSSPSVSNPREVRYAWQSNPAATLFNGAGLPAVPFRTDTWTGMTESHRPY

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
66 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10058516 3300009098 Bacteria 3469
2 rootH2_10017742 3300003320 Bacteria 5167
3 Ga0070658_10017102 3300005327 Bacteria 5804
4 Ga0070658_10021654 3300005327 Bacteria 5152
5 Ga0070658_10070729 3300005327 Bacteria 2857
6 Ga0070683_100000083 3300005329 Bacteria 64346
7 Ga0070683_100001155 3300005329 Bacteria 19993
8 Ga0070680_100008027 3300005336 Bacteria 8062
9 Ga0070660_100005254 3300005339 Bacteria 8953
10 Ga0070661_100009773 3300005344 Bacteria 6654
11 Ga0070709_10001538 3300005434 Bacteria 12452
12 Ga0070714_100000904 3300005435 Bacteria 21045
13 Ga0070714_100064955 3300005435 Bacteria 3143
14 Ga0070711_100027117 3300005439 Bacteria 3759
15 Ga0070711_100050284 3300005439 Bacteria 2858
16 Ga0070681_10000718 3300005458 Bacteria 27408
17 Ga0070681_10002555 3300005458 Bacteria 16704
18 Ga0070681_10109808 3300005458 Bacteria 2698
19 Ga0070679_100012729 3300005530 Bacteria 8045
20 Ga0070679_100104996 3300005530 Bacteria 2811
21 Ga0070684_100000075 3300005535 Bacteria 64346
22 Ga0068855_100003131 3300005563 Bacteria 20246
23 Ga0068855_100015109 3300005563 Bacteria 9296
24 Ga0068855_100032964 3300005563 Bacteria 6184
25 Ga0068855_100080811 3300005563 Bacteria 3769
26 Ga0068856_100000343 3300005614 Bacteria 50941
27 Ga0068856_100035809 3300005614 Unclassified 4865
28 Ga0068852_100000038 3300005616 Bacteria 96977
29 Ga0068852_100005987 3300005616 Bacteria 8762
30 Ga0070712_100004679 3300006175 Bacteria 8462
31 Ga0105240_10000965 3300009093 Bacteria 51267
32 Ga0105240_10004576 3300009093 Bacteria 20972
33 Ga0114129_10271082 3300009147 Unclassified 2271
34 Ga0105238_10002810 3300009551 Bacteria 17370
35 Ga0105238_10004364 3300009551 Bacteria 14027
36 Ga0105238_10011557 3300009551 Bacteria 8896
37 Ga0105238_10020191 3300009551 Bacteria 6781
38 Ga0157371_10048552 3300013102 Bacteria 3017
39 Ga0157370_10000102 3300013104 Bacteria 97420
40 Ga0157370_10018684 3300013104 Bacteria 6970
41 Ga0157369_10000154 3300013105 Bacteria 97000
42 Ga0157369_10000867 3300013105 Bacteria 38585
43 Ga0157369_10002969 3300013105 Bacteria 20295
44 Ga0157369_10003374 3300013105 Bacteria 18974
45 Ga0157369_10024924 3300013105 Bacteria 6646
46 Ga0157369_10091385 3300013105 Bacteria 3249
47 Ga0157374_10004402 3300013296 Bacteria 11851
48 Ga0163162_10008213 3300013306 Bacteria 10186
49 Ga0157372_10000082 3300013307 Bacteria 99224
50 Ga0157372_10001512 3300013307 Bacteria 25278
51 Ga0157372_10020497 3300013307 Bacteria 7134
52 Ga0213875_10005560 3300021388 Bacteria 6746
53 Ga0207699_10000006 3300025906 Bacteria 430147
54 Ga0207705_10009004 3300025909 Bacteria 7274
55 Ga0207707_10003215 3300025912 Bacteria 14508
56 Ga0207695_10000035 3300025913 Bacteria 486590
57 Ga0207695_10002830 3300025913 Bacteria 25208
58 Ga0207695_10005697 3300025913 Bacteria 16426
59 Ga0207695_10040791 3300025913 Bacteria 4973
60 Ga0207693_10004180 3300025915 Bacteria 12246
61 Ga0207663_10038371 3300025916 Bacteria 2895
62 Ga0207660_10011776 3300025917 Bacteria 5701
63 Ga0207660_10042060 3300025917 Bacteria 3206
64 Ga0207657_10001807 3300025919 Bacteria 23076
65 Ga0207657_10004342 3300025919 Bacteria 15018
66 Ga0207652_10046260 3300025921 Bacteria 3712
67 Ga0207652_10103565 3300025921 Bacteria 2516
68 Ga0207700_10002490 3300025928 Bacteria 10559
69 Ga0207700_10022382 3300025928 Bacteria 4337
70 Ga0207664_10005684 3300025929 Bacteria 8525
71 Ga0207664_10054163 3300025929 Bacteria 3178
72 Ga0207661_10000051 3300025944 Bacteria 92442
73 Ga0207667_10000727 3300025949 Bacteria 42774
74 Ga0207667_10001498 3300025949 Bacteria 29322
75 Ga0207667_10018965 3300025949 Bacteria 7692
76 Ga0207667_10042298 3300025949 Bacteria 4844
77 Ga0207667_10044064 3300025949 Bacteria 4731
78 Ga0207667_10069267 3300025949 Bacteria 3672
79 Ga0207667_10073534 3300025949 Bacteria 3551
80 Ga0207702_10002155 3300026078 Bacteria 18919
81 Ga0207702_10006748 3300026078 Bacteria 9854
82 Ga0207698_10000032 3300026142 Bacteria 112742
83 Ga0207698_10049597 3300026142 Unclassified 3197
84 Ga0265337_1000321 3300028556 Bacteria 25660
85 Ga0265337_1000736 3300028556 Bacteria 17247
86 Ga0265337_1000983 3300028556 Bacteria 14892
87 Ga0265319_1004162 3300028563 Bacteria 7247
88 Ga0265318_10016282 3300028577 Unclassified 3075
89 Ga0265336_10000732 3300028666 Bacteria 17401
90 Ga0265336_10011381 3300028666 Bacteria 3027
91 Ga0265336_10018107 3300028666 Bacteria 2286
92 Ga0307515_10000005 3300028794 Bacteria 758563
93 Ga0265338_10000029 3300028800 Bacteria 271824
94 Ga0265338_10000197 3300028800 Bacteria 113587
95 Ga0265338_10000331 3300028800 Bacteria 85997
96 Ga0265338_10000797 3300028800 Bacteria 53302
97 Ga0265338_10000885 3300028800 Bacteria 50545
98 Ga0265338_10001155 3300028800 Bacteria 43671
99 Ga0265338_10001890 3300028800 Bacteria 32781
100 Ga0265338_10001946 3300028800 Bacteria 32248
101 Ga0265338_10002743 3300028800 Bacteria 25841
102 Ga0265338_10003737 3300028800 Bacteria 21162
103 Ga0265338_10005369 3300028800 Bacteria 16754
104 Ga0265338_10010570 3300028800 Bacteria 10797
105 Ga0265338_10013754 3300028800 Bacteria 9100
106 Ga0265338_10021819 3300028800 Bacteria 6656
107 Ga0265338_10024667 3300028800 Bacteria 6136
108 Ga0265324_10000369 3300029957 Bacteria 32612
109 Ga0265330_10000315 3300031235 Bacteria 34828
110 Ga0265330_10016290 3300031235 Bacteria 3430
111 Ga0265332_10017804 3300031238 Unclassified 3135
112 Ga0265328_10006683 3300031239 Unclassified 4856
113 Ga0265320_10001800 3300031240 Bacteria 15191
114 Ga0265320_10002165 3300031240 Bacteria 13789
115 Ga0265320_10002921 3300031240 Bacteria 11706
116 Ga0265320_10011740 3300031240 Bacteria 5140
117 Ga0265320_10014240 3300031240 Unclassified 4537
118 Ga0265325_10000510 3300031241 Bacteria 28118
119 Ga0265325_10006776 3300031241 Bacteria 6929
120 Ga0265329_10001410 3300031242 Bacteria 11634
121 Ga0265340_10002017 3300031247 Bacteria 11625
122 Ga0265340_10011454 3300031247 Bacteria 4711
123 Ga0265339_10000025 3300031249 Bacteria 169559
124 Ga0265339_10001359 3300031249 Bacteria 18276
125 Ga0265339_10001588 3300031249 Bacteria 16820
126 Ga0265339_10014973 3300031249 Bacteria 4662
127 Ga0265331_10005308 3300031250 Bacteria 7798
128 Ga0265316_10040146 3300031344 Unclassified 3754
129 Ga0265316_10056125 3300031344 Bacteria 3079
130 Ga0265316_10091142 3300031344 Unclassified 2326
131 Ga0265313_10000410 3300031595 Bacteria 46063
132 Ga0265313_10019498 3300031595 Bacteria 3770
133 Ga0307508_10000071 3300031616 Bacteria 118790
134 Ga0265314_10000027 3300031711 Bacteria 278331
135 Ga0265314_10000375 3300031711 Bacteria 61300
136 Ga0265314_10002623 3300031711 Bacteria 18139
137 Ga0265314_10002781 3300031711 Bacteria 17476
138 Ga0265314_10032213 3300031711 Bacteria 3858
139 Ga0265314_10032906 3300031711 Bacteria 3808
140 Ga0265314_10092189 3300031711 Bacteria 1970
141 Ga0265342_10003182 3300031712 Bacteria 13662
142 Ga0265342_10018539 3300031712 Unclassified 4505
143 Ga0265342_10023153 3300031712 Unclassified 3936
144 Ga0373928_0000062 3300035084 Bacteria 18930
145 Ga0373949_0003343 3300035090 Bacteria 3848
146 Ga0373951_0003274 3300035091 Bacteria 3959
147 Ga0373932_0000007 3300035112 Bacteria 207459
148 Ga0373945_0001923 3300035116 Bacteria 6445
149 Ga0373954_0044342 3300035118 Bacteria 2075
150 Ga0373962_0000246 3300035242 Bacteria 11513
151 Ga0373931_0000024 3300035691 Bacteria 129909
152 Ga0373927_0006586 3300035695 Bacteria 7912
153 Ga0373927_0015827 3300035695 Bacteria 4976
154 Ga0373937_0010216 3300036401 Bacteria 8190
155 Ga0373925_0000197 3300037068 Bacteria 65779
156 Ga0395905_0001390 3300037471 Bacteria 29354
157 Ga0395905_0044111 3300037471 Bacteria 4184
158 Ga0436364_0035132 3300037853 Bacteria 2192
159 Ga0436364_0926383 3300037853 Bacteria 15136
160 Ga0436361_0548546 3300039447 Bacteria 30262
161 Ga0453684_0057823 3300044712 Bacteria 5014
162 Ga0495592_0070555 3300046454 Bacteria 2545
163 Ga0495628_0125674 3300046516 Bacteria 1965
164 Ga0495630_0000038 3300046517 Bacteria 113319
165 Ga0495666_0011733 3300046526 Bacteria 4369
166 Ga0495586_0000011 3300046535 Bacteria 139442
167 Ga0495586_0005002 3300046535 Bacteria 7094
168 Ga0495634_0021590 3300046642 Bacteria 4548
169 Ga0495613_0007521 3300046689 Bacteria 8109
170 Ga0495674_0008671 3300047319 Bacteria 9667
171 Ga0495676_0001695 3300047321 Bacteria 19249
172 Ga0495684_0006560 3300047471 Bacteria 9024
173 Ga0495686_0037748 3300047472 Bacteria 3093
174 Ga0496101_0115606 3300048904 Unclassified 2024
175 Ga0501031_0083526 3300049568 Bacteria 2081
176 Ga0501032_0000168 3300049569 Bacteria 53390
177 Ga0501036_0012674 3300049572 Bacteria 6994
178 Ga0501037_0061313 3300049573 Bacteria 2742
179 Ga0501046_0004723 3300049580 Bacteria 12286
180 Ga0501047_0046398 3300049581 Bacteria 4199
181 Ga0501035_0056027 3300049822 Bacteria 3519
182 Ga0501044_0050089 3300049823 Bacteria 4310
183 2788435691 2786546940 Bacteria 6396474
184 Ga0105245_10058516
185 rootH2_10017742
186 Ga0070658_10017102
187 Ga0070658_10021654
188 Ga0070658_10070729
189 Ga0070683_100000083
190 Ga0070683_100001155
191 Ga0070680_100008027
192 Ga0070660_100005254
193 Ga0070661_100009773
194 Ga0070709_10001538
195 Ga0070714_100000904
196 Ga0070714_100064955
197 Ga0070711_100027117
198 Ga0070711_100050284
199 Ga0070681_10000718
200 Ga0070681_10002555
201 Ga0070681_10109808
202 Ga0070679_100012729
203 Ga0070679_100104996
204 Ga0070684_100000075
205 Ga0068855_100003131
206 Ga0068855_100015109
207 Ga0068855_100032964
208 Ga0068855_100080811
209 Ga0068856_100000343
210 Ga0068856_100035809
211 Ga0068852_100000038
212 Ga0068852_100005987
213 Ga0070712_100004679
214 Ga0105240_10000965
215 Ga0105240_10004576
216 Ga0114129_10271082
217 Ga0105238_10002810
218 Ga0105238_10004364
219 Ga0105238_10011557
220 Ga0105238_10020191
221 Ga0157371_10048552
222 Ga0157370_10000102
223 Ga0157370_10018684
224 Ga0157369_10000154
225 Ga0157369_10000867
226 Ga0157369_10002969
227 Ga0157369_10003374
228 Ga0157369_10024924
229 Ga0157369_10091385
230 Ga0157374_10004402
231 Ga0163162_10008213
232 Ga0157372_10000082
233 Ga0157372_10001512
234 Ga0157372_10020497
235 Ga0213875_10005560
236 Ga0207699_10000006
237 Ga0207705_10009004
238 Ga0207707_10003215
239 Ga0207695_10000035
240 Ga0207695_10002830
241 Ga0207695_10005697
242 Ga0207695_10040791
243 Ga0207693_10004180
244 Ga0207663_10038371
245 Ga0207660_10011776
246 Ga0207660_10042060
247 Ga0207657_10001807
248 Ga0207657_10004342
249 Ga0207652_10046260
250 Ga0207652_10103565
251 Ga0207700_10002490
252 Ga0207700_10022382
253 Ga0207664_10005684
254 Ga0207664_10054163
255 Ga0207661_10000051
256 Ga0207667_10000727
257 Ga0207667_10001498
258 Ga0207667_10018965
259 Ga0207667_10042298
260 Ga0207667_10044064
261 Ga0207667_10069267
262 Ga0207667_10073534
263 Ga0207702_10002155
264 Ga0207702_10006748
265 Ga0207698_10000032
266 Ga0207698_10049597
267 Ga0265337_1000321
268 Ga0265337_1000736
269 Ga0265337_1000983
270 Ga0265319_1004162
271 Ga0265318_10016282
272 Ga0265336_10000732
273 Ga0265336_10011381
274 Ga0265336_10018107
275 Ga0307515_10000005
276 Ga0265338_10000029
277 Ga0265338_10000197
278 Ga0265338_10000331
279 Ga0265338_10000797
280 Ga0265338_10000885
281 Ga0265338_10001155
282 Ga0265338_10001890
283 Ga0265338_10001946
284 Ga0265338_10002743
285 Ga0265338_10003737
286 Ga0265338_10005369
287 Ga0265338_10010570
288 Ga0265338_10013754
289 Ga0265338_10021819
290 Ga0265338_10024667
291 Ga0265324_10000369
292 Ga0265330_10000315
293 Ga0265330_10016290
294 Ga0265332_10017804
295 Ga0265328_10006683
296 Ga0265320_10001800
297 Ga0265320_10002165
298 Ga0265320_10002921
299 Ga0265320_10011740
300 Ga0265320_10014240
301 Ga0265325_10000510
302 Ga0265325_10006776
303 Ga0265329_10001410
304 Ga0265340_10002017
305 Ga0265340_10011454
306 Ga0265339_10000025
307 Ga0265339_10001359
308 Ga0265339_10001588
309 Ga0265339_10014973
310 Ga0265331_10005308
311 Ga0265316_10040146
312 Ga0265316_10056125
313 Ga0265316_10091142
314 Ga0265313_10000410
315 Ga0265313_10019498
316 Ga0307508_10000071
317 Ga0265314_10000027
318 Ga0265314_10000375
319 Ga0265314_10002623
320 Ga0265314_10002781
321 Ga0265314_10032213
322 Ga0265314_10032906
323 Ga0265314_10092189
324 Ga0265342_10003182
325 Ga0265342_10018539
326 Ga0265342_10023153
327 Ga0373928_0000062
328 Ga0373949_0003343
329 Ga0373951_0003274
330 Ga0373932_0000007
331 Ga0373945_0001923
332 Ga0373954_0044342
333 Ga0373962_0000246
334 Ga0373931_0000024
335 Ga0373927_0006586
336 Ga0373927_0015827
337 Ga0373937_0010216
338 Ga0373925_0000197
339 Ga0395905_0001390
340 Ga0395905_0044111
341 Ga0436364_0035132
342 Ga0436364_0926383
343 Ga0436361_0548546
344 Ga0453684_0057823
345 Ga0495592_0070555
346 Ga0495628_0125674
347 Ga0495630_0000038
348 Ga0495666_0011733
349 Ga0495586_0000011
350 Ga0495586_0005002
351 Ga0495634_0021590
352 Ga0495613_0007521
353 Ga0495674_0008671
354 Ga0495676_0001695
355 Ga0495684_0006560
356 Ga0495686_0037748
357 Ga0496101_0115606
358 Ga0501031_0083526
359 Ga0501032_0000168
360 Ga0501036_0012674
361 Ga0501037_0061313
362 Ga0501046_0004723
363 Ga0501047_0046398
364 Ga0501035_0056027
365 Ga0501044_0050089
366 2788435691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03629

SASA

Carbohydrate esterase, sialic acid-specific acetylesterase

448

580

0.72

PF03629

SASA

Carbohydrate esterase, sialic acid-specific acetylesterase

151

262

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kmm-assembly2.cif.gz_B crystal structure of xac1771, a novel carbohydrate acetylesterase from xanthomonas citri 0.9311 22 644
7kmm-assembly2.cif.gz_B crystal structure of xac1771, a novel carbohydrate acetylesterase from xanthomonas citri 0.9269 22 644
7kmm-assembly1.cif.gz_A crystal structure of xac1771, a novel carbohydrate acetylesterase from xanthomonas citri 0.9256 22 644
7kmm-assembly1.cif.gz_A crystal structure of xac1771, a novel carbohydrate acetylesterase from xanthomonas citri 0.9215 22 644
5n6u-assembly2.cif.gz_D crystal structure of beta-d-mannosidase from dictyoglomus thermophilum. 0.839 290 358
ID Description Score Start End Superfamily
5n6uB01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8392 290 358 2.60.120.260
af_Q93324_19_213_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8036 291 359 2.60.120.260
af_O00462_20_208_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8025 291 359 2.60.120.260
6bjqA01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.793 252 357 2.60.120.260
af_Q9HAT2_118_393_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7819 104 533 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A5N7YZQ2-F1-model_v4 deleted 0.9628 413 644
AF-A0A2B7ZV22-F1-model_v4 Sialate O-acetylesterase 0.9558 554 644 GO:0001681
GO:0005975
AF-A0A660QGQ1-F1-model_v4 Sialate O-acetylesterase domain-containing protein 0.9555 422 642 GO:0001681
GO:0005975
AF-X0UNH5-F1-model_v4 Sialate O-acetylesterase 0.9555 548 644 GO:0001681
GO:0005975
AF-B4DBC3-F1-model_v4 Sialate O-acetylesterase domain-containing protein 0.9551 422 644 GO:0001681
GO:0005975

Map