F282226

General Info

Members Datasets Scaffolds Average Seq Length
184 144 368 188

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100953148|Ga0070665_1009531481
Length 219
Sequence MNASSCHRALVADRGFAGGRGGRRPALAADDVVIAHLRGRIFEKHPNRLVVDVAGVGYDVFVPLSTFYGLGDPGSEIALRVHTHVREDALALYGFATGLEQDLFERLIGVSGIGPKLALAVLSGIDPPELVRAIERGDVTSERIVLELKDRLPRAQPVAAGTDAAAAGAPLLRDDLLSALMNLGYHRPLADKAVDAAVKAAPDGDFERTLKQALKELAK

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
82 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
83 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
84 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
85 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100953148 3300005548 Bacteria 870
2 Ga0065707_10096972 3300005295 Bacteria 3215
3 Ga0070658_10144027 3300005327 Bacteria 1992
4 Ga0070690_100029402 3300005330 Bacteria 3408
5 Ga0070670_100004018 3300005331 Bacteria 12279
6 Ga0070666_10009938 3300005335 Bacteria 5939
7 Ga0070687_100003822 3300005343 Bacteria 5914
8 Ga0070674_101240571 3300005356 Bacteria 663
9 Ga0070714_100005580 3300005435 Bacteria 9611
10 Ga0070711_100536654 3300005439 Bacteria 969
11 Ga0070708_100048944 3300005445 Bacteria 3739
12 Ga0070708_100450707 3300005445 Bacteria 1214
13 Ga0070662_100139858 3300005457 Bacteria 1875
14 Ga0070681_10102842 3300005458 Bacteria 2802
15 Ga0070706_100465528 3300005467 Bacteria 1176
16 Ga0070707_100161972 3300005468 Bacteria 2180
17 Ga0070698_100929205 3300005471 Bacteria 816
18 Ga0070697_100808051 3300005536 Bacteria 830
19 Ga0070672_100206588 3300005543 Bacteria 1644
20 Ga0070686_100028847 3300005544 Bacteria 3369
21 Ga0070695_100167886 3300005545 Bacteria 1546
22 Ga0070704_100020062 3300005549 Bacteria 4303
23 Ga0070704_100232483 3300005549 Bacteria 1505
24 Ga0070664_100158071 3300005564 Bacteria 2004
25 Ga0068857_100074183 3300005577 Bacteria 3032
26 Ga0068861_100114022 3300005719 Bacteria 2169
27 Ga0068858_100004373 3300005842 Bacteria 13863
28 Ga0068860_100588934 3300005843 Bacteria 1117
29 Ga0068860_100808722 3300005843 Unclassified 951
30 Ga0068862_100666157 3300005844 Unclassified 1005
31 Ga0070717_10224168 3300006028 Bacteria 1653
32 Ga0070716_100639526 3300006173 Unclassified 805
33 Ga0097621_100400417 3300006237 Bacteria 1229
34 Ga0068871_100059848 3300006358 Bacteria 3105
35 Ga0068871_100078133 3300006358 Bacteria 2736
36 Ga0075431_100190718 3300006847 Bacteria 2100
37 Ga0075434_100616887 3300006871 Bacteria 1104
38 Ga0075429_100133142 3300006880 Bacteria 2175
39 Ga0075436_100070336 3300006914 Bacteria 2419
40 Ga0075435_100346420 3300007076 Bacteria 1273
41 Ga0105240_10029559 3300009093 Bacteria 7136
42 Ga0111539_10110764 3300009094 Bacteria 3222
43 Ga0111539_10226060 3300009094 Bacteria 2180
44 Ga0105247_10004063 3300009101 Bacteria 9407
45 Ga0114129_10007307 3300009147 Bacteria 15733
46 Ga0114129_10007344 3300009147 Bacteria 15689
47 Ga0114129_10011974 3300009147 Bacteria 12336
48 Ga0114129_10012896 3300009147 Bacteria 11893
49 Ga0114129_10651919 3300009147 Bacteria 1359
50 Ga0105248_10039996 3300009177 Bacteria 5255
51 Ga0105248_10084089 3300009177 Bacteria 3579
52 Ga0105248_10232534 3300009177 Bacteria 2075
53 Ga0105248_10258277 3300009177 Bacteria 1961
54 Ga0105246_10598473 3300011119 Bacteria 952
55 Ga0157378_10002694 3300013297 Bacteria 15816
56 Ga0163162_10494434 3300013306 Bacteria 1354
57 Ga0157380_11485507 3300014326 Unclassified 730
58 Ga0157379_10014968 3300014968 Bacteria 6803
59 Ga0213876_10110195 3300021384 Bacteria 1461
60 Ga0207710_10046240 3300025900 Bacteria 1943
61 Ga0207680_10003662 3300025903 Bacteria 7222
62 Ga0207685_10208848 3300025905 Bacteria 922
63 Ga0207705_10053607 3300025909 Bacteria 2906
64 Ga0207684_10469761 3300025910 Bacteria 1079
65 Ga0207707_10067600 3300025912 Bacteria 3113
66 Ga0207695_10255761 3300025913 Bacteria 1650
67 Ga0207695_10432097 3300025913 Bacteria 1201
68 Ga0207662_10062930 3300025918 Bacteria 2230
69 Ga0207646_10122638 3300025922 Bacteria 2335
70 Ga0207694_10096685 3300025924 Bacteria 2336
71 Ga0207650_10015200 3300025925 Bacteria 5357
72 Ga0207690_10680081 3300025932 Unclassified 845
73 Ga0207691_10250352 3300025940 Bacteria 1529
74 Ga0207711_10121043 3300025941 Bacteria 2336
75 Ga0207711_10194721 3300025941 Bacteria 1848
76 Ga0207711_10526248 3300025941 Bacteria 1102
77 Ga0207679_10297384 3300025945 Bacteria 1390
78 Ga0207651_10429531 3300025960 Bacteria 1129
79 Ga0207668_10120241 3300025972 Bacteria 1988
80 Ga0207674_10029982 3300026116 Bacteria 5723
81 Ga0207675_100222188 3300026118 Bacteria 1820
82 Ga0207428_10022376 3300027907 Bacteria 5336
83 Ga0207428_10292300 3300027907 Bacteria 1207
84 Ga0268265_10287140 3300028380 Bacteria 1475
85 Ga0268264_10511643 3300028381 Bacteria 1172
86 Ga0268264_11250421 3300028381 Unclassified 752
87 Ga0307406_10371101 3300031901 Bacteria 1125
88 Ga0307416_100107531 3300032002 Bacteria 2448
89 Ga0373956_0124025 3300035119 Bacteria 1207
90 Ga0373943_0155369 3300035170 Bacteria 1242
91 Ga0373955_0103254 3300035172 Bacteria 1639
92 Ga0373924_0010240 3300035410 Bacteria 3451
93 Ga0373931_0114339 3300035691 Bacteria 1535
94 Ga0373931_0507584 3300035691 Bacteria 779
95 Ga0373927_0191071 3300035695 Bacteria 1343
96 Ga0373947_0010816 3300035725 Bacteria 5237
97 Ga0373947_0672400 3300035725 Unclassified 706
98 Ga0373937_0115348 3300036401 Bacteria 2501
99 Ga0373925_0046004 3300037068 Bacteria 3243
100 Ga0439453_0004367 3300041408 Bacteria 2099
101 Ga0439441_005229 3300042001 Bacteria 2005
102 Ga0439443_053303 3300042003 Bacteria 712
103 Ga0439435_0024169 3300042436 Bacteria 1601
104 Ga0439444_0005949 3300042437 Bacteria 1825
105 Ga0453683_0531882 3300044673 Bacteria 764
106 Ga0495592_0044739 3300046454 Bacteria 3306
107 Ga0495603_0252610 3300046455 Bacteria 1015
108 Ga0495580_0154590 3300046472 Bacteria 1589
109 Ga0495582_0176043 3300046473 Bacteria 1219
110 Ga0495639_0238148 3300046475 Bacteria 898
111 Ga0495664_0164821 3300046477 Bacteria 1345
112 Ga0495608_0006754 3300046511 Bacteria 8135
113 Ga0495628_0026102 3300046516 Bacteria 4769
114 Ga0495666_0159018 3300046526 Bacteria 1048
115 Ga0495645_0012788 3300046543 Bacteria 5922
116 Ga0495634_0075058 3300046642 Bacteria 2221
117 Ga0495634_0088712 3300046642 Bacteria 2011
118 Ga0495646_0281651 3300046680 Bacteria 883
119 Ga0495647_0043504 3300046681 Bacteria 1719
120 Ga0495658_0016100 3300046683 Bacteria 3847
121 Ga0495658_0017715 3300046683 Bacteria 3687
122 Ga0495669_0001134 3300046684 Bacteria 11020
123 Ga0495669_0114691 3300046684 Bacteria 1260
124 Ga0495613_0012260 3300046689 Bacteria 6370
125 Ga0495670_0334612 3300046691 Bacteria 814
126 Ga0495604_0045587 3300047317 Bacteria 3421
127 Ga0495674_0015359 3300047319 Bacteria 7162
128 Ga0495680_0160460 3300047322 Bacteria 1633
129 Ga0495684_0001031 3300047471 Bacteria 22610
130 Ga0495614_0284426 3300048089 Bacteria 762
131 Ga0496102_0024057 3300048905 Bacteria 5414
132 Ga0496108_0543398 3300048911 Unclassified 1014
133 Ga0496110_0768972 3300048913 Bacteria 867
134 Ga0496112_0255744 3300048915 Bacteria 1702
135 Ga0501031_0355607 3300049568 Bacteria 948
136 Ga0501033_0343645 3300049570 Bacteria 1046
137 Ga0501036_0020670 3300049572 Bacteria 5530
138 Ga0501038_0157708 3300049574 Bacteria 1847
139 Ga0501039_0571114 3300049575 Bacteria 887
140 Ga0501040_0009429 3300049576 Bacteria 6364
141 Ga0501040_0362976 3300049576 Unclassified 1038
142 Ga0501042_0038051 3300049578 Bacteria 3416
143 Ga0501042_0253778 3300049578 Bacteria 1269
144 Ga0501043_0390742 3300049579 Bacteria 1052
145 Ga0501046_0310509 3300049580 Bacteria 1150
146 Ga0501072_0052203 3300049588 Bacteria 3219
147 Ga0501072_0177728 3300049588 Bacteria 1698
148 Ga0501074_0044209 3300049590 Bacteria 3225
149 Ga0501075_0074796 3300049591 Bacteria 2562
150 Ga0501076_0149275 3300049592 Bacteria 1901
151 Ga0501076_0188417 3300049592 Bacteria 1683
152 Ga0501076_0384615 3300049592 Bacteria 1153
153 Ga0501077_0089788 3300049593 Bacteria 1947
154 Ga0501077_0694658 3300049593 Bacteria 654
155 Ga0501079_0071783 3300049741 Bacteria 2675
156 Ga0501079_0394535 3300049741 Bacteria 1085
157 Ga0501080_0849855 3300049742 Bacteria 798
158 Ga0501081_1043119 3300049743 Bacteria 618
159 Ga0501045_0008164 3300049824 Bacteria 7293
160 nmdc:mga05p37_10862_c1 3300050507 Bacteria 10811
161 nmdc:mga05p37_109613_c1 3300050507 Bacteria 3396
162 nmdc:mga05p37_13533_c1 3300050507 Bacteria 9781
163 nmdc:mga05p37_177158_c1 3300050507 Bacteria 2597
164 nmdc:mga05p37_437779_c1 3300050507 Bacteria 1517
165 nmdc:mga05p37_661037_c1 3300050507 Bacteria 1168
166 nmdc:mga05p37_73294_c1 3300050507 Bacteria 4214
167 nmdc:mga05p37_81819_c1 3300050507 Bacteria 3978
168 nmdc:mga09592_25857_c1 3300050508 Bacteria 4861
169 nmdc:mga06r32_255906_c1 3300050510 Bacteria 1738
170 nmdc:mga08y16_33260_c1 3300050511 Bacteria 5416
171 nmdc:mga0n895_151857_c1 3300050512 Bacteria 2346
172 nmdc:mga0rr50_313417_c1 3300050513 Bacteria 1314
173 nmdc:mga08x19_2483_c1 3300050514 Bacteria 11220
174 Ga0495601_0220611 3300053077 Unclassified 1238
175 Ga0495612_0157125 3300053078 Unclassified 992
176 Ga0495595_0069283 3300053084 Bacteria 1665
177 Ga0495595_0144721 3300053084 Unclassified 1167
178 Ga0495619_0007406 3300053085 Bacteria 6956
179 Ga0495619_0016903 3300053085 Bacteria 4621
180 Ga0495619_0104525 3300053085 Bacteria 1930
181 Ga0501084_0011024 3300054114 Bacteria 7487
182 Ga0501084_0089178 3300054114 Bacteria 2589
183 Ga0501082_0181174 3300060353 Bacteria 1832
184 Ga0530510_0192399 3300061734 Bacteria 1514
185 Ga0070665_100953148
186 Ga0065707_10096972
187 Ga0070658_10144027
188 Ga0070690_100029402
189 Ga0070670_100004018
190 Ga0070666_10009938
191 Ga0070687_100003822
192 Ga0070674_101240571
193 Ga0070714_100005580
194 Ga0070711_100536654
195 Ga0070708_100048944
196 Ga0070708_100450707
197 Ga0070662_100139858
198 Ga0070681_10102842
199 Ga0070706_100465528
200 Ga0070707_100161972
201 Ga0070698_100929205
202 Ga0070697_100808051
203 Ga0070672_100206588
204 Ga0070686_100028847
205 Ga0070695_100167886
206 Ga0070704_100020062
207 Ga0070704_100232483
208 Ga0070664_100158071
209 Ga0068857_100074183
210 Ga0068861_100114022
211 Ga0068858_100004373
212 Ga0068860_100588934
213 Ga0068860_100808722
214 Ga0068862_100666157
215 Ga0070717_10224168
216 Ga0070716_100639526
217 Ga0097621_100400417
218 Ga0068871_100059848
219 Ga0068871_100078133
220 Ga0075431_100190718
221 Ga0075434_100616887
222 Ga0075429_100133142
223 Ga0075436_100070336
224 Ga0075435_100346420
225 Ga0105240_10029559
226 Ga0111539_10110764
227 Ga0111539_10226060
228 Ga0105247_10004063
229 Ga0114129_10007307
230 Ga0114129_10007344
231 Ga0114129_10011974
232 Ga0114129_10012896
233 Ga0114129_10651919
234 Ga0105248_10039996
235 Ga0105248_10084089
236 Ga0105248_10232534
237 Ga0105248_10258277
238 Ga0105246_10598473
239 Ga0157378_10002694
240 Ga0163162_10494434
241 Ga0157380_11485507
242 Ga0157379_10014968
243 Ga0213876_10110195
244 Ga0207710_10046240
245 Ga0207680_10003662
246 Ga0207685_10208848
247 Ga0207705_10053607
248 Ga0207684_10469761
249 Ga0207707_10067600
250 Ga0207695_10255761
251 Ga0207695_10432097
252 Ga0207662_10062930
253 Ga0207646_10122638
254 Ga0207694_10096685
255 Ga0207650_10015200
256 Ga0207690_10680081
257 Ga0207691_10250352
258 Ga0207711_10121043
259 Ga0207711_10194721
260 Ga0207711_10526248
261 Ga0207679_10297384
262 Ga0207651_10429531
263 Ga0207668_10120241
264 Ga0207674_10029982
265 Ga0207675_100222188
266 Ga0207428_10022376
267 Ga0207428_10292300
268 Ga0268265_10287140
269 Ga0268264_10511643
270 Ga0268264_11250421
271 Ga0307406_10371101
272 Ga0307416_100107531
273 Ga0373956_0124025
274 Ga0373943_0155369
275 Ga0373955_0103254
276 Ga0373924_0010240
277 Ga0373931_0114339
278 Ga0373931_0507584
279 Ga0373927_0191071
280 Ga0373947_0010816
281 Ga0373947_0672400
282 Ga0373937_0115348
283 Ga0373925_0046004
284 Ga0439453_0004367
285 Ga0439441_005229
286 Ga0439443_053303
287 Ga0439435_0024169
288 Ga0439444_0005949
289 Ga0453683_0531882
290 Ga0495592_0044739
291 Ga0495603_0252610
292 Ga0495580_0154590
293 Ga0495582_0176043
294 Ga0495639_0238148
295 Ga0495664_0164821
296 Ga0495608_0006754
297 Ga0495628_0026102
298 Ga0495666_0159018
299 Ga0495645_0012788
300 Ga0495634_0075058
301 Ga0495634_0088712
302 Ga0495646_0281651
303 Ga0495647_0043504
304 Ga0495658_0016100
305 Ga0495658_0017715
306 Ga0495669_0001134
307 Ga0495669_0114691
308 Ga0495613_0012260
309 Ga0495670_0334612
310 Ga0495604_0045587
311 Ga0495674_0015359
312 Ga0495680_0160460
313 Ga0495684_0001031
314 Ga0495614_0284426
315 Ga0496102_0024057
316 Ga0496108_0543398
317 Ga0496110_0768972
318 Ga0496112_0255744
319 Ga0501031_0355607
320 Ga0501033_0343645
321 Ga0501036_0020670
322 Ga0501038_0157708
323 Ga0501039_0571114
324 Ga0501040_0009429
325 Ga0501040_0362976
326 Ga0501042_0038051
327 Ga0501042_0253778
328 Ga0501043_0390742
329 Ga0501046_0310509
330 Ga0501072_0052203
331 Ga0501072_0177728
332 Ga0501074_0044209
333 Ga0501075_0074796
334 Ga0501076_0149275
335 Ga0501076_0188417
336 Ga0501076_0384615
337 Ga0501077_0089788
338 Ga0501077_0694658
339 Ga0501079_0071783
340 Ga0501079_0394535
341 Ga0501080_0849855
342 Ga0501081_1043119
343 Ga0501045_0008164
344 nmdc:mga05p37_10862_c1
345 nmdc:mga05p37_109613_c1
346 nmdc:mga05p37_13533_c1
347 nmdc:mga05p37_177158_c1
348 nmdc:mga05p37_437779_c1
349 nmdc:mga05p37_661037_c1
350 nmdc:mga05p37_73294_c1
351 nmdc:mga05p37_81819_c1
352 nmdc:mga09592_25857_c1
353 nmdc:mga06r32_255906_c1
354 nmdc:mga08y16_33260_c1
355 nmdc:mga0n895_151857_c1
356 nmdc:mga0rr50_313417_c1
357 nmdc:mga08x19_2483_c1
358 Ga0495601_0220611
359 Ga0495612_0157125
360 Ga0495595_0069283
361 Ga0495595_0144721
362 Ga0495619_0007406
363 Ga0495619_0016903
364 Ga0495619_0104525
365 Ga0501084_0011024
366 Ga0501084_0089178
367 Ga0501082_0181174
368 Ga0530510_0192399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

34

94

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

171

218

0.96

PF14520

HHH_5

Helix-hairpin-helix domain

104

150

0.77

Map