F281946

General Info

Members Datasets Scaffolds Average Seq Length
184 159 368 156

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100000002|Ga0070670_100000002147
Length 143
Sequence MNAVENPRPPLPPFTLETATQKVRMAEDAWNSHDPLKVSLAYTPDSIWRNRSEFLSGREAIVQFLTRKWSRELDYRLIKELWAFHQNRIAVRFAYEWHDDAGGFMHRRIASINDLPITAAERKFHWPLGRRPDAHPSLTELNL

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
153 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
157 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
158 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
159 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0.54
Rhizoplane 1.63
Rhizosphere 86.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100000002 3300005331 Bacteria 568775
2 JGI24752J21851_1009453 3300001976 Bacteria 1272
3 rootL2_10058842 3300003322 Bacteria 7275
4 Ga0070691_10050938 3300005341 Bacteria 1976
5 Ga0070691_10487922 3300005341 Bacteria 710
6 Ga0070661_100296545 3300005344 Bacteria 1257
7 Ga0070669_100001400 3300005353 Bacteria 17405
8 Ga0070675_100219662 3300005354 Bacteria 1655
9 Ga0070671_100000047 3300005355 Bacteria 84234
10 Ga0070671_100947748 3300005355 Bacteria 753
11 Ga0070674_100946718 3300005356 Bacteria 753
12 Ga0070688_100385975 3300005365 Bacteria 1033
13 Ga0070659_100289875 3300005366 Bacteria 1363
14 Ga0070667_100000018 3300005367 Bacteria 226033
15 Ga0070667_100543451 3300005367 Bacteria 1067
16 Ga0070678_101443934 3300005456 Bacteria 643
17 Ga0070662_100759898 3300005457 Bacteria 822
18 Ga0070681_10017748 3300005458 Bacteria 7112
19 Ga0070685_11106599 3300005466 Bacteria 599
20 Ga0070707_101337797 3300005468 Bacteria 683
21 Ga0070684_100306217 3300005535 Bacteria 1458
22 Ga0070697_100123812 3300005536 Bacteria 2164
23 Ga0068853_100353335 3300005539 Bacteria 1368
24 Ga0068855_100009095 3300005563 Bacteria 12006
25 Ga0070664_100614573 3300005564 Bacteria 1008
26 Ga0068854_100823716 3300005578 Bacteria 811
27 Ga0068856_100228669 3300005614 Bacteria 1875
28 Ga0070702_100105610 3300005615 Bacteria 1736
29 Ga0068864_100000003 3300005618 Bacteria 568775
30 Ga0068866_10167928 3300005718 Bacteria 1286
31 Ga0068863_100723480 3300005841 Bacteria 990
32 Ga0068863_101558600 3300005841 Bacteria 669
33 Ga0068858_100067676 3300005842 Bacteria 3308
34 Ga0070717_10148080 3300006028 Bacteria 2029
35 Ga0070712_100150863 3300006175 Bacteria 1784
36 Ga0070712_100554240 3300006175 Bacteria 969
37 Ga0097621_101080214 3300006237 Bacteria 753
38 Ga0068871_101071441 3300006358 Bacteria 753
39 Ga0075430_100001190 3300006846 Bacteria 20852
40 Ga0075430_100917265 3300006846 Bacteria 722
41 Ga0075431_100003732 3300006847 Bacteria 14801
42 Ga0075435_100344612 3300007076 Bacteria 1277
43 Ga0075435_100439909 3300007076 Bacteria 1124
44 Ga0075435_100792302 3300007076 Bacteria 825
45 Ga0105247_10071139 3300009101 Bacteria 2175
46 Ga0105248_11023170 3300009177 Bacteria 933
47 Ga0105237_10553929 3300009545 Bacteria 1156
48 Ga0105249_10027212 3300009553 Bacteria 5159
49 Ga0105239_10345099 3300010375 Bacteria 1681
50 Ga0157369_10054067 3300013105 Bacteria 4336
51 Ga0157374_10284781 3300013296 Bacteria 1632
52 Ga0163162_10092107 3300013306 Bacteria 3114
53 Ga0163163_10000132 3300014325 Bacteria 76574
54 Ga0163163_10062855 3300014325 Bacteria 3680
55 Ga0157376_10963666 3300014969 Bacteria 874
56 Ga0213872_10015752 3300021361 Bacteria 3512
57 Ga0213874_10039948 3300021377 Bacteria 1399
58 Ga0213876_10643439 3300021384 Bacteria 564
59 Ga0207642_10259368 3300025899 Bacteria 990
60 Ga0207710_10020283 3300025900 Bacteria 2841
61 Ga0207680_10008744 3300025903 Bacteria 4987
62 Ga0207645_10396798 3300025907 Bacteria 927
63 Ga0207707_10345561 3300025912 Bacteria 1282
64 Ga0207693_10114746 3300025915 Bacteria 2114
65 Ga0207649_10083076 3300025920 Bacteria 2078
66 Ga0207652_10087980 3300025921 Bacteria 2724
67 Ga0207652_10832350 3300025921 Bacteria 818
68 Ga0207681_10000256 3300025923 Bacteria 40485
69 Ga0207650_10000003 3300025925 Bacteria 1123235
70 Ga0207659_10142922 3300025926 Bacteria 1859
71 Ga0207644_10000055 3300025931 Bacteria 84281
72 Ga0207690_10261552 3300025932 Bacteria 1341
73 Ga0207669_10405910 3300025937 Bacteria 1069
74 Ga0207669_10922935 3300025937 Bacteria 730
75 Ga0207661_11237663 3300025944 Bacteria 686
76 Ga0207679_10160885 3300025945 Bacteria 1838
77 Ga0207667_10003516 3300025949 Bacteria 19374
78 Ga0207658_10000004 3300025986 Bacteria 569357
79 Ga0207703_10016214 3300026035 Bacteria 5807
80 Ga0207639_10178212 3300026041 Bacteria 1806
81 Ga0207702_10048042 3300026078 Bacteria 3598
82 Ga0207641_10029012 3300026088 Bacteria 4574
83 Ga0207648_10165130 3300026089 Bacteria 1956
84 Ga0207676_10000003 3300026095 Bacteria 1123235
85 Ga0209969_1009778 3300027360 Bacteria 1368
86 Ga0209983_1079530 3300027665 Bacteria 734
87 Ga0207428_10081147 3300027907 Bacteria 2533
88 Ga0268266_10496682 3300028379 Bacteria 1165
89 Ga0307512_10021831 3300030522 Bacteria 5765
90 Ga0265330_10009216 3300031235 Bacteria 4701
91 Ga0265328_10003433 3300031239 Bacteria 6997
92 Ga0265328_10164675 3300031239 Bacteria 837
93 Ga0265339_10005943 3300031249 Bacteria 8073
94 Ga0265331_10011433 3300031250 Bacteria 4861
95 Ga0265327_10000080 3300031251 Bacteria 206086
96 Ga0265313_10059944 3300031595 Bacteria 1787
97 Ga0307508_10669326 3300031616 Bacteria 645
98 Ga0265314_10431097 3300031711 Bacteria 706
99 Ga0265342_10034126 3300031712 Bacteria 3123
100 Ga0307516_10000057 3300031730 Bacteria 122512
101 Ga0307410_10977468 3300031852 Bacteria 729
102 Ga0307412_11065378 3300031911 Bacteria 718
103 Ga0307510_10036795 3300033180 Bacteria 5444
104 Ga0307510_10055984 3300033180 Bacteria 4113
105 Ga0373956_0147847 3300035119 Bacteria 1105
106 Ga0373957_0122064 3300035120 Bacteria 1055
107 Ga0373960_0211557 3300035121 Bacteria 690
108 Ga0373943_0145617 3300035170 Bacteria 1280
109 Ga0373955_0014497 3300035172 Bacteria 3836
110 Ga0316574_0038493 3300035398 Bacteria 2936
111 Ga0316574_0319493 3300035398 Bacteria 986
112 Ga0373924_0365095 3300035410 Bacteria 644
113 Ga0373931_0082338 3300035691 Bacteria 1779
114 Ga0373931_0428573 3300035691 Bacteria 842
115 Ga0373927_0090154 3300035695 Bacteria 1991
116 Ga0373933_0015310 3300035724 Bacteria 4276
117 Ga0373933_0266558 3300035724 Bacteria 1105
118 Ga0373947_0251824 3300035725 Bacteria 1168
119 Ga0373937_0020815 3300036401 Bacteria 5884
120 Ga0395899_0655020 3300037312 Bacteria 663
121 Ga0395900_0041819 3300037418 Bacteria 4723
122 Ga0395900_0458930 3300037418 Bacteria 1229
123 Ga0395905_0119562 3300037471 Bacteria 2476
124 Ga0395901_0011336 3300038443 Bacteria 9033
125 Ga0395901_0032845 3300038443 Bacteria 5354
126 Ga0436365_1133384 3300039437 Bacteria 833
127 Ga0436363_0705980 3300039450 Bacteria 523
128 Ga0466972_0240608 3300044658 Bacteria 847
129 Ga0466965_0032747 3300044683 Bacteria 2539
130 Ga0466966_0054912 3300044684 Bacteria 2523
131 Ga0453684_2061008 3300044712 Bacteria 573
132 Ga0466970_0106786 3300044765 Bacteria 1527
133 Ga0451576_0227588 3300045051 Bacteria 1947
134 Ga0466967_0264846 3300045976 Bacteria 1645
135 Ga0495650_0234660 3300046471 Bacteria 628
136 Ga0495580_0010638 3300046472 Bacteria 7149
137 Ga0495594_0091457 3300046499 Bacteria 1705
138 Ga0495607_0003305 3300046501 Bacteria 12384
139 Ga0495583_0007053 3300046506 Bacteria 7182
140 Ga0495606_0000196 3300046507 Bacteria 105765
141 Ga0495606_0055961 3300046507 Bacteria 2548
142 Ga0495628_0693802 3300046516 Bacteria 720
143 Ga0495654_0000998 3300046530 Bacteria 20842
144 Ga0495645_0272219 3300046543 Bacteria 1117
145 Ga0495659_0154571 3300046664 Bacteria 923
146 Ga0495649_0049921 3300046694 Bacteria 2272
147 Ga0495589_0017287 3300046794 Bacteria 3703
148 Ga0495680_0094063 3300047322 Bacteria 2243
149 Ga0495683_0017824 3300047323 Bacteria 3676
150 Ga0495687_000051 3300047443 Bacteria 200568
151 Ga0495687_005023 3300047443 Bacteria 8633
152 Ga0495687_065427 3300047443 Bacteria 1480
153 Ga0495686_0000029 3300047472 Bacteria 369110
154 Ga0496101_0618750 3300048904 Bacteria 856
155 Ga0496108_1167014 3300048911 Bacteria 652
156 Ga0496110_0057503 3300048913 Bacteria 3424
157 Ga0496121_0020640 3300048924 Bacteria 6505
158 Ga0496124_0059169 3300048927 Bacteria 3219
159 Ga0496124_0168566 3300048927 Bacteria 1699
160 Ga0496125_0019286 3300048928 Bacteria 6439
161 Ga0496125_0245230 3300048928 Bacteria 1134
162 Ga0496126_0456133 3300048929 Bacteria 1028
163 Ga0501047_1048435 3300049581 Bacteria 629
164 Ga0501077_0248554 3300049593 Bacteria 1131
165 Ga0501241_152198 3300049758 Bacteria 534
166 Ga0501035_0304788 3300049822 Bacteria 1341
167 Ga0501035_0739197 3300049822 Bacteria 790
168 nmdc:mga0qj67_5349_c1 3300050509 Bacteria 9370
169 nmdc:mga0qj67_726630_c1 3300050509 Bacteria 789
170 nmdc:mga08y16_1408912_c1 3300050511 Bacteria 660
171 nmdc:mga0rr50_1212109_c1 3300050513 Bacteria 641
172 nmdc:mga0a205_223688_c1 3300050515 Bacteria 1767
173 Ga0495601_0069434 3300053077 Bacteria 2247
174 Ga0495595_0259107 3300053084 Bacteria 871
175 Ga0495619_0008426 3300053085 Bacteria 6518
176 Ga0500643_057532 3300053087 Bacteria 1097
177 Ga0500555_006116 3300053103 Bacteria 3421
178 Ga0500618_001586 3300053125 Bacteria 9908
179 Ga0590071_123056 3300059421 Bacteria 663
180 Ga0590074_055997 3300059423 Bacteria 727
181 2510132162 2510065019 Bacteria 6903379
182 2812366124 2811994881 Bacteria 6298475
183 2894514355 2894510363 Bacteria 5121143
184 2923520147 2923519811 Bacteria 6298479
185 Ga0070670_100000002
186 JGI24752J21851_1009453
187 rootL2_10058842
188 Ga0070691_10050938
189 Ga0070691_10487922
190 Ga0070661_100296545
191 Ga0070669_100001400
192 Ga0070675_100219662
193 Ga0070671_100000047
194 Ga0070671_100947748
195 Ga0070674_100946718
196 Ga0070688_100385975
197 Ga0070659_100289875
198 Ga0070667_100000018
199 Ga0070667_100543451
200 Ga0070678_101443934
201 Ga0070662_100759898
202 Ga0070681_10017748
203 Ga0070685_11106599
204 Ga0070707_101337797
205 Ga0070684_100306217
206 Ga0070697_100123812
207 Ga0068853_100353335
208 Ga0068855_100009095
209 Ga0070664_100614573
210 Ga0068854_100823716
211 Ga0068856_100228669
212 Ga0070702_100105610
213 Ga0068864_100000003
214 Ga0068866_10167928
215 Ga0068863_100723480
216 Ga0068863_101558600
217 Ga0068858_100067676
218 Ga0070717_10148080
219 Ga0070712_100150863
220 Ga0070712_100554240
221 Ga0097621_101080214
222 Ga0068871_101071441
223 Ga0075430_100001190
224 Ga0075430_100917265
225 Ga0075431_100003732
226 Ga0075435_100344612
227 Ga0075435_100439909
228 Ga0075435_100792302
229 Ga0105247_10071139
230 Ga0105248_11023170
231 Ga0105237_10553929
232 Ga0105249_10027212
233 Ga0105239_10345099
234 Ga0157369_10054067
235 Ga0157374_10284781
236 Ga0163162_10092107
237 Ga0163163_10000132
238 Ga0163163_10062855
239 Ga0157376_10963666
240 Ga0213872_10015752
241 Ga0213874_10039948
242 Ga0213876_10643439
243 Ga0207642_10259368
244 Ga0207710_10020283
245 Ga0207680_10008744
246 Ga0207645_10396798
247 Ga0207707_10345561
248 Ga0207693_10114746
249 Ga0207649_10083076
250 Ga0207652_10087980
251 Ga0207652_10832350
252 Ga0207681_10000256
253 Ga0207650_10000003
254 Ga0207659_10142922
255 Ga0207644_10000055
256 Ga0207690_10261552
257 Ga0207669_10405910
258 Ga0207669_10922935
259 Ga0207661_11237663
260 Ga0207679_10160885
261 Ga0207667_10003516
262 Ga0207658_10000004
263 Ga0207703_10016214
264 Ga0207639_10178212
265 Ga0207702_10048042
266 Ga0207641_10029012
267 Ga0207648_10165130
268 Ga0207676_10000003
269 Ga0209969_1009778
270 Ga0209983_1079530
271 Ga0207428_10081147
272 Ga0268266_10496682
273 Ga0307512_10021831
274 Ga0265330_10009216
275 Ga0265328_10003433
276 Ga0265328_10164675
277 Ga0265339_10005943
278 Ga0265331_10011433
279 Ga0265327_10000080
280 Ga0265313_10059944
281 Ga0307508_10669326
282 Ga0265314_10431097
283 Ga0265342_10034126
284 Ga0307516_10000057
285 Ga0307410_10977468
286 Ga0307412_11065378
287 Ga0307510_10036795
288 Ga0307510_10055984
289 Ga0373956_0147847
290 Ga0373957_0122064
291 Ga0373960_0211557
292 Ga0373943_0145617
293 Ga0373955_0014497
294 Ga0316574_0038493
295 Ga0316574_0319493
296 Ga0373924_0365095
297 Ga0373931_0082338
298 Ga0373931_0428573
299 Ga0373927_0090154
300 Ga0373933_0015310
301 Ga0373933_0266558
302 Ga0373947_0251824
303 Ga0373937_0020815
304 Ga0395899_0655020
305 Ga0395900_0041819
306 Ga0395900_0458930
307 Ga0395905_0119562
308 Ga0395901_0011336
309 Ga0395901_0032845
310 Ga0436365_1133384
311 Ga0436363_0705980
312 Ga0466972_0240608
313 Ga0466965_0032747
314 Ga0466966_0054912
315 Ga0453684_2061008
316 Ga0466970_0106786
317 Ga0451576_0227588
318 Ga0466967_0264846
319 Ga0495650_0234660
320 Ga0495580_0010638
321 Ga0495594_0091457
322 Ga0495607_0003305
323 Ga0495583_0007053
324 Ga0495606_0000196
325 Ga0495606_0055961
326 Ga0495628_0693802
327 Ga0495654_0000998
328 Ga0495645_0272219
329 Ga0495659_0154571
330 Ga0495649_0049921
331 Ga0495589_0017287
332 Ga0495680_0094063
333 Ga0495683_0017824
334 Ga0495687_000051
335 Ga0495687_005023
336 Ga0495687_065427
337 Ga0495686_0000029
338 Ga0496101_0618750
339 Ga0496108_1167014
340 Ga0496110_0057503
341 Ga0496121_0020640
342 Ga0496124_0059169
343 Ga0496124_0168566
344 Ga0496125_0019286
345 Ga0496125_0245230
346 Ga0496126_0456133
347 Ga0501047_1048435
348 Ga0501077_0248554
349 Ga0501241_152198
350 Ga0501035_0304788
351 Ga0501035_0739197
352 nmdc:mga0qj67_5349_c1
353 nmdc:mga0qj67_726630_c1
354 nmdc:mga08y16_1408912_c1
355 nmdc:mga0rr50_1212109_c1
356 nmdc:mga0a205_223688_c1
357 Ga0495601_0069434
358 Ga0495595_0259107
359 Ga0495619_0008426
360 Ga0500643_057532
361 Ga0500555_006116
362 Ga0500618_001586
363 Ga0590071_123056
364 Ga0590074_055997
365 2510132162
366 2812366124
367 2894514355
368 2923520147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

12

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9961 5 156
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9832 5 156
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.883 20 127
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8818 17 126
3sed-assembly1.cif.gz_A crystal structure of ketosteroid isomerase variant m105a from pseudomonos putida 0.8811 15 126
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9998 15 156 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9927 15 156 3.10.450.50
af_A0A1D8PD11_9_180_2.40.160.20 Mainly Beta;Beta Barrel;Porin; 0.8901 87 116 2.40.160.20
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8777 42 129 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8682 17 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A529HV08-F1-model_v4 deleted 1.006 8 95
AF-A0A176FRT9-F1-model_v4 DUF4440 domain-containing protein 1.005 7 124
AF-A0A533J3Y5-F1-model_v4 deleted 1.005 8 106
AF-A0A436F433-F1-model_v4 DUF1348 family protein 1.005 8 108
AF-J8V0J8-F1-model_v4 deleted 1.005 71 159

Map