F281703
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 183 | 140 | 155 | 357 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2919450847|2919455725 |
| Length | 397 |
| Sequence | VGDTNPIWYLWLAKYQTWLYWVFQQHKKPFRLGGMTVQLLVLPGDGIGPEITAATLRALNVLNDCCSIDIRWTEADIGLKSLREQGTTLPEAVLEGVRAADGVLLGPVSHYEYPSRQEGGINPSGELRTRFELFANIRPCRSLSDLSILRRPMDLIIVRENTEGFYSDRNMVAGTGEFMPDENMALSVRKITARASGQVARAAFELARGRRKKVTAVHKANVLKLSDGLFLREVRKVAADYPDVALEELIVDATAAHLIRTPDRFDLIVTTNMFGDILSDEASELCGSLGLGGSISVGDGICVAQAQHGSAPDIAGRGIANPTSLMLSAAMLLDWRGRRDGDTALIDAAAAFEQAVGKVLTNPATRTADLGGALSTEAFTDAVCAAIARSSAAGQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 3 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 4 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 5 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 6 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 7 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 8 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 9 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 10 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 11 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 12 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 13 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 14 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 15 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 16 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 17 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 18 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 19 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 20 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 21 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 22 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 23 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 24 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 25 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 26 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 61 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 80 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 81 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 82 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 83 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 84 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 90 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 91 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 92 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 94 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 95 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 96 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 97 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 98 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 117 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 120 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 123 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 124 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 126 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 127 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 128 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 129 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 130 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 131 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 132 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 133 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 134 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 135 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 136 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 137 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 138 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 139 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 140 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.7 |
| Metatranscriptomes | 0 |
| Isolates | 15.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.57 |
| Nodule | 7.1 |
| Rhizoplane | 2.73 |
| Rhizosphere | 53.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10022949 | 3300003203 | Bacteria | 2473 |
| 2 | JGI25406J46586_10042627 | 3300003203 | Bacteria | 1586 |
| 3 | Ga0055530_10008514 | 3300003791 | Unclassified | 4093 |
| 4 | Ga0068869_100021805 | 3300005334 | Bacteria | 4409 |
| 5 | Ga0070668_100001766 | 3300005347 | Bacteria | 15733 |
| 6 | Ga0070668_100251899 | 3300005347 | Bacteria | 1466 |
| 7 | Ga0070667_100315235 | 3300005367 | Bacteria | 1410 |
| 8 | Ga0070700_100241588 | 3300005441 | Bacteria | 1291 |
| 9 | Ga0070665_100066562 | 3300005548 | Bacteria | 3614 |
| 10 | Ga0068855_100300366 | 3300005563 | Bacteria | 1778 |
| 11 | Ga0068854_100011516 | 3300005578 | Bacteria | 5763 |
| 12 | Ga0068859_100001577 | 3300005617 | Bacteria | 23231 |
| 13 | Ga0068859_100347903 | 3300005617 | Bacteria | 1577 |
| 14 | Ga0068863_100082615 | 3300005841 | Bacteria | 3045 |
| 15 | Ga0068858_100041361 | 3300005842 | Bacteria | 4274 |
| 16 | Ga0068862_100028370 | 3300005844 | Bacteria | 4713 |
| 17 | Ga0081455_10006926 | 3300005937 | Bacteria | 12058 |
| 18 | Ga0081539_10001722 | 3300005985 | Bacteria | 34982 |
| 19 | Ga0081539_10002049 | 3300005985 | Bacteria | 30300 |
| 20 | Ga0070717_10010030 | 3300006028 | Bacteria | 7131 |
| 21 | Ga0097620_100001577 | 3300006931 | Bacteria | 23231 |
| 22 | Ga0097620_100347935 | 3300006931 | Bacteria | 1577 |
| 23 | Ga0099826_10087012 | 3300006948 | Bacteria | 1924 |
| 24 | Ga0105240_10012382 | 3300009093 | Bacteria | 11779 |
| 25 | Ga0105240_10045207 | 3300009093 | Bacteria | 5588 |
| 26 | Ga0105240_10097272 | 3300009093 | Bacteria | 3587 |
| 27 | Ga0105247_10005796 | 3300009101 | Bacteria | 7731 |
| 28 | Ga0105241_10401345 | 3300009174 | Bacteria | 1202 |
| 29 | Ga0105248_10106526 | 3300009177 | Bacteria | 3161 |
| 30 | Ga0105237_10016459 | 3300009545 | Bacteria | 7681 |
| 31 | Ga0105237_10495956 | 3300009545 | Bacteria | 1228 |
| 32 | Ga0105238_10226776 | 3300009551 | Bacteria | 1845 |
| 33 | Ga0105238_10265672 | 3300009551 | Bacteria | 1696 |
| 34 | Ga0105239_10000164 | 3300010375 | Bacteria | 95286 |
| 35 | Ga0157373_10002467 | 3300013100 | Bacteria | 14096 |
| 36 | Ga0157370_10004389 | 3300013104 | Bacteria | 16192 |
| 37 | Ga0157369_10005322 | 3300013105 | Bacteria | 14994 |
| 38 | Ga0163163_10223274 | 3300014325 | Bacteria | 1933 |
| 39 | Ga0157379_10012532 | 3300014968 | Bacteria | 7405 |
| 40 | Ga0163161_10063653 | 3300017792 | Bacteria | 2689 |
| 41 | Ga0213873_10004637 | 3300021358 | Bacteria | 2581 |
| 42 | Ga0213876_10001227 | 3300021384 | Bacteria | 16194 |
| 43 | Ga0213876_10003908 | 3300021384 | Bacteria | 8426 |
| 44 | Ga0213876_10005321 | 3300021384 | Bacteria | 7081 |
| 45 | Ga0213875_10003057 | 3300021388 | Bacteria | 9677 |
| 46 | Ga0209050_1000776 | 3300025298 | Bacteria | 45644 |
| 47 | Ga0209256_1000866 | 3300025299 | Bacteria | 37550 |
| 48 | Ga0207426_1000092 | 3300025302 | Bacteria | 278907 |
| 49 | Ga0207710_10019201 | 3300025900 | Bacteria | 2916 |
| 50 | Ga0207695_10002727 | 3300025913 | Bacteria | 25767 |
| 51 | Ga0207695_10103074 | 3300025913 | Bacteria | 2845 |
| 52 | Ga0207671_10310033 | 3300025914 | Bacteria | 1247 |
| 53 | Ga0207662_10094322 | 3300025918 | Bacteria | 1846 |
| 54 | Ga0207694_10156721 | 3300025924 | Bacteria | 1837 |
| 55 | Ga0207711_10153503 | 3300025941 | Bacteria | 2079 |
| 56 | Ga0207689_10029318 | 3300025942 | Bacteria | 4596 |
| 57 | Ga0207667_10253400 | 3300025949 | Bacteria | 1801 |
| 58 | Ga0207668_10004450 | 3300025972 | Bacteria | 8232 |
| 59 | Ga0207668_10248292 | 3300025972 | Bacteria | 1444 |
| 60 | Ga0207658_10011740 | 3300025986 | Bacteria | 5966 |
| 61 | Ga0207703_10048692 | 3300026035 | Bacteria | 3422 |
| 62 | Ga0207708_10236033 | 3300026075 | Bacteria | 1469 |
| 63 | Ga0268266_10002401 | 3300028379 | Bacteria | 20182 |
| 64 | Ga0268266_10074550 | 3300028379 | Bacteria | 2947 |
| 65 | Ga0268264_10053175 | 3300028381 | Bacteria | 3378 |
| 66 | Ga0307515_10015266 | 3300028794 | Bacteria | 14164 |
| 67 | Ga0307515_10022415 | 3300028794 | Bacteria | 11131 |
| 68 | Ga0307515_10127954 | 3300028794 | Bacteria | 2821 |
| 69 | Ga0307511_10000100 | 3300030521 | Bacteria | 75671 |
| 70 | Ga0307511_10063921 | 3300030521 | Bacteria | 2773 |
| 71 | Ga0307511_10065201 | 3300030521 | Bacteria | 2729 |
| 72 | Ga0307512_10006160 | 3300030522 | Bacteria | 12256 |
| 73 | Ga0307513_10001782 | 3300031456 | Bacteria | 30627 |
| 74 | Ga0307513_10002978 | 3300031456 | Bacteria | 23090 |
| 75 | Ga0307513_10116012 | 3300031456 | Bacteria | 2659 |
| 76 | Ga0307513_10123156 | 3300031456 | Bacteria | 2555 |
| 77 | Ga0307513_10238646 | 3300031456 | Bacteria | 1625 |
| 78 | Ga0307509_10168497 | 3300031507 | Bacteria | 2074 |
| 79 | Ga0307509_10251855 | 3300031507 | Bacteria | 1549 |
| 80 | Ga0307508_10035206 | 3300031616 | Bacteria | 4513 |
| 81 | Ga0316576_10111945 | 3300031727 | Bacteria | 2046 |
| 82 | Ga0307516_10011435 | 3300031730 | Bacteria | 9642 |
| 83 | Ga0307516_10058493 | 3300031730 | Bacteria | 3752 |
| 84 | Ga0307405_10001490 | 3300031731 | Bacteria | 9900 |
| 85 | Ga0307412_10092535 | 3300031911 | Bacteria | 2119 |
| 86 | Ga0307416_100137758 | 3300032002 | Bacteria | 2212 |
| 87 | Ga0307414_10163801 | 3300032004 | Bacteria | 1770 |
| 88 | Ga0307507_10058130 | 3300033179 | Bacteria | 3634 |
| 89 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 90 | Ga0307510_10088398 | 3300033180 | Bacteria | 2958 |
| 91 | Ga0373936_0000007 | 3300035113 | Bacteria | 290641 |
| 92 | Ga0373936_0017026 | 3300035113 | Bacteria | 2795 |
| 93 | Ga0395905_0118080 | 3300037471 | Bacteria | 2493 |
| 94 | Ga0436364_1020870 | 3300037853 | Bacteria | 4078 |
| 95 | Ga0436365_0260170 | 3300039437 | Bacteria | 52235 |
| 96 | Ga0436365_0336706 | 3300039437 | Bacteria | 7082 |
| 97 | Ga0436365_1132171 | 3300039437 | Bacteria | 10498 |
| 98 | Ga0436362_0624758 | 3300039453 | Bacteria | 4681 |
| 99 | Ga0439436_0021857 | 3300041404 | Bacteria | 1898 |
| 100 | Ga0450907_007712 | 3300042146 | Bacteria | 1795 |
| 101 | Ga0466966_0019686 | 3300044684 | Bacteria | 4440 |
| 102 | Ga0495638_0017208 | 3300046460 | Bacteria | 4825 |
| 103 | Ga0495584_0017053 | 3300046491 | Bacteria | 3702 |
| 104 | Ga0495606_0095323 | 3300046507 | Bacteria | 1823 |
| 105 | Ga0495610_0035765 | 3300046512 | Bacteria | 2545 |
| 106 | Ga0495632_0000038 | 3300046519 | Bacteria | 155743 |
| 107 | Ga0495637_0000061 | 3300046520 | Bacteria | 95460 |
| 108 | Ga0495643_0000088 | 3300046522 | Bacteria | 155458 |
| 109 | Ga0495663_0000013 | 3300046525 | Bacteria | 155493 |
| 110 | Ga0495633_0000166 | 3300046558 | Bacteria | 86835 |
| 111 | Ga0495633_0000471 | 3300046558 | Bacteria | 41052 |
| 112 | Ga0495633_0034735 | 3300046558 | Bacteria | 2423 |
| 113 | Ga0495668_0123935 | 3300046616 | Bacteria | 1414 |
| 114 | Ga0495625_0000274 | 3300046660 | Bacteria | 80067 |
| 115 | Ga0495625_0000884 | 3300046660 | Bacteria | 40584 |
| 116 | Ga0495625_0002395 | 3300046660 | Bacteria | 20345 |
| 117 | Ga0495625_0105010 | 3300046660 | Bacteria | 1936 |
| 118 | Ga0495670_0007959 | 3300046691 | Bacteria | 5211 |
| 119 | Ga0495671_0000048 | 3300046692 | Bacteria | 155712 |
| 120 | Ga0495672_0059128 | 3300047320 | Bacteria | 2219 |
| 121 | Ga0495681_0005188 | 3300047470 | Bacteria | 8759 |
| 122 | Ga0495686_0000124 | 3300047472 | Bacteria | 159708 |
| 123 | Ga0495686_0034667 | 3300047472 | Bacteria | 3249 |
| 124 | Ga0495686_0126268 | 3300047472 | Bacteria | 1520 |
| 125 | Ga0496105_0072023 | 3300048908 | Bacteria | 2856 |
| 126 | Ga0496107_0142026 | 3300048910 | Bacteria | 1775 |
| 127 | Ga0496108_0196642 | 3300048911 | Bacteria | 1749 |
| 128 | Ga0496110_0025483 | 3300048913 | Bacteria | 5054 |
| 129 | Ga0496111_0039340 | 3300048914 | Bacteria | 3390 |
| 130 | Ga0496121_0000072 | 3300048924 | Bacteria | 244975 |
| 131 | Ga0496121_0000587 | 3300048924 | Bacteria | 68273 |
| 132 | Ga0496122_0001210 | 3300048925 | Bacteria | 43846 |
| 133 | Ga0496126_0001309 | 3300048929 | Bacteria | 39651 |
| 134 | Ga0496126_0021868 | 3300048929 | Bacteria | 6240 |
| 135 | Ga0496126_0233460 | 3300048929 | Bacteria | 1540 |
| 136 | Ga0501068_0131919 | 3300049584 | Bacteria | 1563 |
| 137 | Ga0500578_0035848 | 3300053086 | Bacteria | 3188 |
| 138 | Ga0500583_0010944 | 3300053092 | Bacteria | 3393 |
| 139 | Ga0500583_0025260 | 3300053092 | Bacteria | 2534 |
| 140 | Ga0500651_0000473 | 3300053093 | Bacteria | 21098 |
| 141 | Ga0500566_0000424 | 3300053094 | Bacteria | 23525 |
| 142 | Ga0500592_001096 | 3300053116 | Bacteria | 4415 |
| 143 | Ga0500595_000115 | 3300053119 | Bacteria | 53482 |
| 144 | Ga0500595_002776 | 3300053119 | Bacteria | 8438 |
| 145 | Ga0500595_022893 | 3300053119 | Bacteria | 2202 |
| 146 | Ga0500614_000138 | 3300053123 | Bacteria | 17937 |
| 147 | Ga0500559_0005577 | 3300053136 | Bacteria | 5775 |
| 148 | Ga0500585_014588 | 3300053144 | Bacteria | 2431 |
| 149 | Ga0500622_0001852 | 3300053156 | Bacteria | 15996 |
| 150 | Ga0500622_0004118 | 3300053156 | Bacteria | 9308 |
| 151 | Ga0500622_0010592 | 3300053156 | Bacteria | 5054 |
| 152 | Ga0500627_0000001 | 3300053158 | Bacteria | 251552 |
| 153 | Ga0500636_0115692 | 3300053177 | Bacteria | 1510 |
| 154 | Ga0500637_0072275 | 3300053178 | Bacteria | 1984 |
| 155 | Ga0500645_003810 | 3300053730 | Bacteria | 5993 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10123156 | Ga0307513_101231562 | 320 |
| 2 | 3300009545 | Ga0105237_10495956 | Ga0105237_104959562 | 326 |
| 3 | 3300009551 | Ga0105238_10226776 | Ga0105238_102267762 | 326 |
| 4 | 3300025914 | Ga0207671_10310033 | Ga0207671_103100332 | 326 |
| 5 | 3300025924 | Ga0207694_10156721 | Ga0207694_101567212 | 326 |
| 6 | 3300021384 | Ga0213876_10005321 | Ga0213876_100053212 | 328 |
| 7 | 3300030521 | Ga0307511_10065201 | Ga0307511_100652012 | 328 |
| 8 | 3300039437 | Ga0436365_0336706 | Ga0436365_0336706_3561_4625 | 328 |
| 9 | 3300032004 | Ga0307414_10163801 | Ga0307414_101638012 | 333 |
| 10 | 3300053092 | Ga0500583_0010944 | Ga0500583_0010944_1941_2945 | 334 |
| 11 | 3300003791 | Ga0055530_10008514 | Ga0055530_100085143 | 336 |
| 12 | 3300025298 | Ga0209050_1000776 | Ga0209050_100077613 | 336 |
| 13 | 3300046660 | Ga0495625_0000884 | Ga0495625_0000884_10255_11325 | 336 |
| 14 | 3300009177 | Ga0105248_10106526 | Ga0105248_101065262 | 340 |
| 15 | 3300025941 | Ga0207711_10153503 | Ga0207711_101535032 | 340 |
| 16 | 3300031730 | Ga0307516_10011435 | Ga0307516_100114352 | 341 |
| 17 | 3300046691 | Ga0495670_0007959 | Ga0495670_0007959_717_1778 | 342 |
| 18 | 3300028794 | Ga0307515_10015266 | Ga0307515_100152667 | 343 |
| 19 | 3300031456 | Ga0307513_10002978 | Ga0307513_1000297812 | 344 |
| 20 | 3300031507 | Ga0307509_10168497 | Ga0307509_101684972 | 344 |
| 21 | 3300048929 | Ga0496126_0233460 | Ga0496126_0233460_177_1262 | 344 |
| 22 | iso_pu_bacteria | 2898795034 | 2898796028 | 344 |
| 23 | 3300005441 | Ga0070700_100241588 | Ga0070700_1002415882 | 345 |
| 24 | 3300026075 | Ga0207708_10236033 | Ga0207708_102360331 | 345 |
| 25 | 3300031616 | Ga0307508_10035206 | Ga0307508_100352063 | 345 |
| 26 | 3300033179 | Ga0307507_10058130 | Ga0307507_100581303 | 345 |
| 27 | 3300053094 | Ga0500566_0000424 | Ga0500566_0000424_747_1877 | 345 |
| 28 | 3300053116 | Ga0500592_001096 | Ga0500592_001096_1640_2680 | 345 |
| 29 | 3300053119 | Ga0500595_000115 | Ga0500595_000115_48583_49713 | 345 |
| 30 | 3300053123 | Ga0500614_000138 | Ga0500614_000138_7566_8696 | 345 |
| 31 | 3300053136 | Ga0500559_0005577 | Ga0500559_0005577_2337_3467 | 345 |
| 32 | 3300053144 | Ga0500585_014588 | Ga0500585_014588_1010_2140 | 345 |
| 33 | 3300053158 | Ga0500627_0000001 | Ga0500627_0000001_50593_51633 | 345 |
| 34 | 3300005334 | Ga0068869_100021805 | Ga0068869_1000218053 | 346 |
| 35 | 3300005617 | Ga0068859_100347903 | Ga0068859_1003479032 | 346 |
| 36 | 3300006931 | Ga0097620_100347935 | Ga0097620_1003479352 | 346 |
| 37 | 3300025918 | Ga0207662_10094322 | Ga0207662_100943222 | 346 |
| 38 | 3300025942 | Ga0207689_10029318 | Ga0207689_100293182 | 346 |
| 39 | 3300035113 | Ga0373936_0000007 | Ga0373936_0000007_213869_215002 | 346 |
| 40 | 3300044684 | Ga0466966_0019686 | Ga0466966_0019686_773_1888 | 347 |
| 41 | 3300006948 | Ga0099826_10087012 | Ga0099826_100870123 | 348 |
| 42 | 3300021388 | Ga0213875_10003057 | Ga0213875_100030573 | 348 |
| 43 | 3300031911 | Ga0307412_10092535 | Ga0307412_100925352 | 348 |
| 44 | 3300037853 | Ga0436364_1020870 | Ga0436364_1020870_1172_2281 | 348 |
| 45 | iso_pu_bacteria | 2554235003 | 2554249097 | 348 |
| 46 | iso_pu_bacteria | 2919166419 | 2919170746 | 348 |
| 47 | 3300005578 | Ga0068854_100011516 | Ga0068854_1000115162 | 349 |
| 48 | 3300021358 | Ga0213873_10004637 | Ga0213873_100046374 | 349 |
| 49 | 3300021384 | Ga0213876_10001227 | Ga0213876_100012274 | 349 |
| 50 | 3300039437 | Ga0436365_1132171 | Ga0436365_1132171_8485_9594 | 349 |
| 51 | 3300039453 | Ga0436362_0624758 | Ga0436362_0624758_2943_4052 | 349 |
| 52 | 3300005563 | Ga0068855_100300366 | Ga0068855_1003003662 | 350 |
| 53 | 3300005844 | Ga0068862_100028370 | Ga0068862_1000283704 | 350 |
| 54 | 3300009093 | Ga0105240_10012382 | Ga0105240_100123827 | 350 |
| 55 | 3300009093 | Ga0105240_10097272 | Ga0105240_100972724 | 350 |
| 56 | 3300009545 | Ga0105237_10016459 | Ga0105237_100164592 | 350 |
| 57 | 3300010375 | Ga0105239_10000164 | Ga0105239_1000016479 | 350 |
| 58 | 3300025913 | Ga0207695_10002727 | Ga0207695_1000272713 | 350 |
| 59 | 3300025913 | Ga0207695_10103074 | Ga0207695_101030744 | 350 |
| 60 | 3300025949 | Ga0207667_10253400 | Ga0207667_102534002 | 350 |
| 61 | 3300028379 | Ga0268266_10002401 | Ga0268266_1000240113 | 350 |
| 62 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005281 | 350 |
| 63 | 3300033180 | Ga0307510_10088398 | Ga0307510_100883983 | 350 |
| 64 | 3300035113 | Ga0373936_0017026 | Ga0373936_0017026_443_1510 | 350 |
| 65 | 3300046507 | Ga0495606_0095323 | Ga0495606_0095323_356_1411 | 350 |
| 66 | 3300046660 | Ga0495625_0000274 | Ga0495625_0000274_25018_26070 | 350 |
| 67 | 3300046660 | Ga0495625_0105010 | Ga0495625_0105010_535_1632 | 350 |
| 68 | 3300048924 | Ga0496121_0000072 | Ga0496121_0000072_111207_112340 | 350 |
| 69 | 3300048924 | Ga0496121_0000587 | Ga0496121_0000587_24775_25830 | 350 |
| 70 | 3300048929 | Ga0496126_0021868 | Ga0496126_0021868_4299_5432 | 350 |
| 71 | iso_pu_bacteria | 2821443989 | 2821449805 | 350 |
| 72 | iso_pu_bacteria | 2842871566 | 2842874986 | 350 |
| 73 | 3300030521 | Ga0307511_10063921 | Ga0307511_100639212 | 351 |
| 74 | 3300031456 | Ga0307513_10116012 | Ga0307513_101160122 | 351 |
| 75 | 3300037471 | Ga0395905_0118080 | Ga0395905_0118080_123_1208 | 351 |
| 76 | 3300046491 | Ga0495584_0017053 | Ga0495584_0017053_338_1393 | 351 |
| 77 | 3300046519 | Ga0495632_0000038 | Ga0495632_0000038_69745_70800 | 351 |
| 78 | 3300046520 | Ga0495637_0000061 | Ga0495637_0000061_52788_53843 | 351 |
| 79 | 3300046522 | Ga0495643_0000088 | Ga0495643_0000088_84494_85549 | 351 |
| 80 | 3300046525 | Ga0495663_0000013 | Ga0495663_0000013_84837_85892 | 351 |
| 81 | 3300046558 | Ga0495633_0000166 | Ga0495633_0000166_56211_57266 | 351 |
| 82 | 3300046558 | Ga0495633_0000471 | Ga0495633_0000471_10144_11199 | 351 |
| 83 | 3300046558 | Ga0495633_0034735 | Ga0495633_0034735_250_1305 | 351 |
| 84 | 3300046616 | Ga0495668_0123935 | Ga0495668_0123935_226_1281 | 351 |
| 85 | 3300046692 | Ga0495671_0000048 | Ga0495671_0000048_84621_85676 | 351 |
| 86 | 3300047470 | Ga0495681_0005188 | Ga0495681_0005188_7297_8352 | 351 |
| 87 | 3300047472 | Ga0495686_0126268 | Ga0495686_0126268_202_1257 | 351 |
| 88 | 3300053119 | Ga0500595_002776 | Ga0500595_002776_439_1524 | 351 |
| 89 | 3300053119 | Ga0500595_022893 | Ga0500595_022893_837_1892 | 351 |
| 90 | 3300013100 | Ga0157373_10002467 | Ga0157373_1000246712 | 352 |
| 91 | 3300013104 | Ga0157370_10004389 | Ga0157370_1000438915 | 352 |
| 92 | 3300013105 | Ga0157369_10005322 | Ga0157369_100053226 | 352 |
| 93 | 3300017792 | Ga0163161_10063653 | Ga0163161_100636532 | 352 |
| 94 | 3300031731 | Ga0307405_10001490 | Ga0307405_100014908 | 352 |
| 95 | 3300048925 | Ga0496122_0001210 | Ga0496122_0001210_1258_2316 | 352 |
| 96 | 3300009174 | Ga0105241_10401345 | Ga0105241_104013451 | 353 |
| 97 | 3300025302 | Ga0207426_1000092 | Ga0207426_1000092153 | 353 |
| 98 | 3300031730 | Ga0307516_10058493 | Ga0307516_100584933 | 353 |
| 99 | 3300041404 | Ga0439436_0021857 | Ga0439436_0021857_338_1399 | 353 |
| 100 | 3300042146 | Ga0450907_007712 | Ga0450907_007712_283_1344 | 353 |
| 101 | 3300046512 | Ga0495610_0035765 | Ga0495610_0035765_1239_2300 | 353 |
| 102 | iso_pu_bacteria | 2508501050 | 2508730068 | 353 |
| 103 | iso_pu_bacteria | 2582581294 | 2585200467 | 353 |
| 104 | iso_pu_bacteria | 2643221734 | 2644734156 | 353 |
| 105 | iso_pu_bacteria | 2773857925 | 2774873241 | 353 |
| 106 | iso_pu_bacteria | 2808606387 | 2808990061 | 353 |
| 107 | iso_pu_bacteria | 2935648319 | 2935651751 | 353 |
| 108 | iso_pu_bacteria | 2935656913 | 2935660561 | 353 |
| 109 | iso_pu_bacteria | 2936011229 | 2936014617 | 353 |
| 110 | iso_pu_bacteria | 2936019824 | 2936023587 | 353 |
| 111 | iso_pu_bacteria | 2936028420 | 2936032615 | 353 |
| 112 | iso_pu_bacteria | 2936046547 | 2936050358 | 353 |
| 113 | iso_pu_bacteria | 2936055302 | 2936059150 | 353 |
| 114 | iso_pu_bacteria | 2989349275 | 2989353570 | 353 |
| 115 | iso_pu_bacteria | 8016630954 | 8016631889 | 353 |
| 116 | 3300005347 | Ga0070668_100001766 | Ga0070668_1000017666 | 354 |
| 117 | 3300005548 | Ga0070665_100066562 | Ga0070665_1000665622 | 354 |
| 118 | 3300025972 | Ga0207668_10004450 | Ga0207668_100044506 | 354 |
| 119 | 3300028379 | Ga0268266_10074550 | Ga0268266_100745502 | 354 |
| 120 | 3300028794 | Ga0307515_10127954 | Ga0307515_101279542 | 354 |
| 121 | 3300031456 | Ga0307513_10238646 | Ga0307513_102386462 | 354 |
| 122 | 3300047320 | Ga0495672_0059128 | Ga0495672_0059128_792_1856 | 354 |
| 123 | 3300047472 | Ga0495686_0034667 | Ga0495686_0034667_2148_3224 | 354 |
| 124 | 3300053156 | Ga0500622_0001852 | Ga0500622_0001852_4215_5279 | 354 |
| 125 | 3300053156 | Ga0500622_0004118 | Ga0500622_0004118_701_1765 | 354 |
| 126 | 3300053156 | Ga0500622_0010592 | Ga0500622_0010592_562_1626 | 354 |
| 127 | 3300053730 | Ga0500645_003810 | Ga0500645_003810_2049_3113 | 354 |
| 128 | 3300005347 | Ga0070668_100251899 | Ga0070668_1002518991 | 355 |
| 129 | 3300025972 | Ga0207668_10248292 | Ga0207668_102482922 | 355 |
| 130 | 3300028794 | Ga0307515_10022415 | Ga0307515_100224159 | 355 |
| 131 | 3300053092 | Ga0500583_0025260 | Ga0500583_0025260_230_1297 | 355 |
| 132 | iso_pu_bacteria | 2643221610 | 2644064533 | 355 |
| 133 | iso_pu_bacteria | 2643221675 | 2644419586 | 355 |
| 134 | iso_pu_bacteria | 2643221680 | 2644452943 | 355 |
| 135 | iso_pu_bacteria | 2643221726 | 2644691934 | 355 |
| 136 | iso_pu_bacteria | 2791355091 | 2792619813 | 355 |
| 137 | iso_pu_bacteria | 2791355261 | 2793326113 | 355 |
| 138 | iso_pu_bacteria | 3003930520 | 3003934287 | 355 |
| 139 | iso_pu_bacteria | 8005382845 | 8005387250 | 355 |
| 140 | 3300003203 | JGI25406J46586_10042627 | JGI25406J46586_100426271 | 356 |
| 141 | 3300005985 | Ga0081539_10001722 | Ga0081539_1000172222 | 356 |
| 142 | 3300030522 | Ga0307512_10006160 | Ga0307512_100061606 | 356 |
| 143 | 3300031456 | Ga0307513_10001782 | Ga0307513_1000178220 | 356 |
| 144 | 3300003203 | JGI25406J46586_10022949 | JGI25406J46586_100229493 | 357 |
| 145 | 3300005367 | Ga0070667_100315235 | Ga0070667_1003152351 | 357 |
| 146 | 3300005617 | Ga0068859_100001577 | Ga0068859_10000157717 | 357 |
| 147 | 3300005841 | Ga0068863_100082615 | Ga0068863_1000826152 | 357 |
| 148 | 3300005842 | Ga0068858_100041361 | Ga0068858_1000413612 | 357 |
| 149 | 3300005937 | Ga0081455_10006926 | Ga0081455_100069268 | 357 |
| 150 | 3300005985 | Ga0081539_10002049 | Ga0081539_1000204912 | 357 |
| 151 | 3300006028 | Ga0070717_10010030 | Ga0070717_100100304 | 357 |
| 152 | 3300006931 | Ga0097620_100001577 | Ga0097620_10000157717 | 357 |
| 153 | 3300009093 | Ga0105240_10045207 | Ga0105240_100452073 | 357 |
| 154 | 3300009101 | Ga0105247_10005796 | Ga0105247_100057963 | 357 |
| 155 | 3300009551 | Ga0105238_10265672 | Ga0105238_102656722 | 357 |
| 156 | 3300014325 | Ga0163163_10223274 | Ga0163163_102232742 | 357 |
| 157 | 3300014968 | Ga0157379_10012532 | Ga0157379_100125325 | 357 |
| 158 | 3300021384 | Ga0213876_10003908 | Ga0213876_100039083 | 357 |
| 159 | 3300025299 | Ga0209256_1000866 | Ga0209256_100086624 | 357 |
| 160 | 3300025900 | Ga0207710_10019201 | Ga0207710_100192014 | 357 |
| 161 | 3300025986 | Ga0207658_10011740 | Ga0207658_100117402 | 357 |
| 162 | 3300026035 | Ga0207703_10048692 | Ga0207703_100486924 | 357 |
| 163 | 3300028381 | Ga0268264_10053175 | Ga0268264_100531752 | 357 |
| 164 | 3300030521 | Ga0307511_10000100 | Ga0307511_1000010021 | 357 |
| 165 | 3300031507 | Ga0307509_10251855 | Ga0307509_102518552 | 357 |
| 166 | 3300031727 | Ga0316576_10111945 | Ga0316576_101119451 | 357 |
| 167 | 3300032002 | Ga0307416_100137758 | Ga0307416_1001377582 | 357 |
| 168 | 3300039437 | Ga0436365_0260170 | Ga0436365_0260170_32913_34025 | 357 |
| 169 | 3300046460 | Ga0495638_0017208 | Ga0495638_0017208_946_2028 | 357 |
| 170 | 3300046660 | Ga0495625_0002395 | Ga0495625_0002395_13277_14437 | 357 |
| 171 | 3300047472 | Ga0495686_0000124 | Ga0495686_0000124_13947_15044 | 357 |
| 172 | 3300048908 | Ga0496105_0072023 | Ga0496105_0072023_1344_2456 | 357 |
| 173 | 3300048910 | Ga0496107_0142026 | Ga0496107_0142026_209_1327 | 357 |
| 174 | 3300048911 | Ga0496108_0196642 | Ga0496108_0196642_149_1261 | 357 |
| 175 | 3300048913 | Ga0496110_0025483 | Ga0496110_0025483_1316_2428 | 357 |
| 176 | 3300048914 | Ga0496111_0039340 | Ga0496111_0039340_1514_2626 | 357 |
| 177 | 3300048929 | Ga0496126_0001309 | Ga0496126_0001309_21291_22367 | 357 |
| 178 | 3300049584 | Ga0501068_0131919 | Ga0501068_0131919_276_1394 | 357 |
| 179 | 3300053086 | Ga0500578_0035848 | Ga0500578_0035848_357_1442 | 357 |
| 180 | 3300053093 | Ga0500651_0000473 | Ga0500651_0000473_10226_11311 | 357 |
| 181 | 3300053177 | Ga0500636_0115692 | Ga0500636_0115692_241_1317 | 357 |
| 182 | 3300053178 | Ga0500637_0072275 | Ga0500637_0072275_522_1604 | 357 |
| 183 | iso_pu_bacteria | 2919450847 | 2919455725 | 357 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wpw-assembly1.cif.gz_A | crystal structure of ipmdh from sulfolobus tokodaii | 0.9258 | 2 | 351 |
| 1x0l-assembly1.cif.gz_B-2 | crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, thermus thermophilus | 0.92 | 2 | 353 |
| 1wpw-assembly1.cif.gz_A | crystal structure of ipmdh from sulfolobus tokodaii | 0.9152 | 2 | 351 |
| 1x0l-assembly1.cif.gz_B-2 | crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, thermus thermophilus | 0.9091 | 2 | 353 |
| 4y1p-assembly1.cif.gz_B-2 | crystal structure of 3-isopropylmalate dehydrogenase (saci_0600) from sulfolobus acidocaldarius complex with 3-isopropylmalate and mg2+ | 0.9058 | 2 | 350 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wpwB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.927 | 2 | 351 | 3.40.718.10 |
| 1x0lB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.92 | 2 | 353 | 3.40.718.10 |
| 1wpwB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9165 | 2 | 351 | 3.40.718.10 |
| 1x0lB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9091 | 2 | 353 | 3.40.718.10 |
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.893 | 2 | 353 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537KXX4-F1-model_v4 | Isocitrate/isopropylmalate dehydrogenase family protein | 0.9747 | 228 | 352 |
GO:0000287
GO:0004449 GO:0006099 GO:0006102 GO:0051287 |
| AF-A0A158M949-F1-model_v4 | 3-isopropylmalate dehydrogenase domain protein | 0.968 | 1 | 97 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A3C0CXA8-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.9642 | 152 | 252 |
GO:0000287
GO:0003862 GO:0051287 |
| AF-A0A150K1N5-F1-model_v4 | deleted | 0.9529 | 143 | 354 |
|
| AF-A0A537KXX4-F1-model_v4 | Isocitrate/isopropylmalate dehydrogenase family protein | 0.9523 | 228 | 352 |
GO:0000287
GO:0004449 GO:0006099 GO:0006102 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar