F281703

General Info

Members Datasets Scaffolds Average Seq Length
183 140 155 357

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919450847|2919455725
Length 397
Sequence VGDTNPIWYLWLAKYQTWLYWVFQQHKKPFRLGGMTVQLLVLPGDGIGPEITAATLRALNVLNDCCSIDIRWTEADIGLKSLREQGTTLPEAVLEGVRAADGVLLGPVSHYEYPSRQEGGINPSGELRTRFELFANIRPCRSLSDLSILRRPMDLIIVRENTEGFYSDRNMVAGTGEFMPDENMALSVRKITARASGQVARAAFELARGRRKKVTAVHKANVLKLSDGLFLREVRKVAADYPDVALEELIVDATAAHLIRTPDRFDLIVTTNMFGDILSDEASELCGSLGLGGSISVGDGICVAQAQHGSAPDIAGRGIANPTSLMLSAAMLLDWRGRRDGDTALIDAAAAFEQAVGKVLTNPATRTADLGGALSTEAFTDAVCAAIARSSAAGQAA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
4 2643221610 Ensifer sp. Root74 Isolate Unclassified
5 2643221675 Ensifer sp. Root1298 Isolate Unclassified
6 2643221680 Ensifer sp. Root1312 Isolate Unclassified
7 2643221726 Ensifer sp. Root954 Isolate Unclassified
8 2643221734 Bosea sp. Root670 Isolate Unclassified
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
11 2791355261 Rhizobium sp. J15 Isolate Nodule
12 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
13 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
14 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
15 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
16 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
17 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
18 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
19 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
20 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
21 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
22 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
23 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
24 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
25 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
26 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
130 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
131 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
136 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
137 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 8005382845 Rhizobium sp. R634 Isolate Nodule
140 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.7
Metatranscriptomes 0
Isolates 15.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.57
Nodule 7.1
Rhizoplane 2.73
Rhizosphere 53.01
Stem 0
Stem Tuber 0
Unclassified 24.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10022949 3300003203 Bacteria 2473
2 JGI25406J46586_10042627 3300003203 Bacteria 1586
3 Ga0055530_10008514 3300003791 Unclassified 4093
4 Ga0068869_100021805 3300005334 Bacteria 4409
5 Ga0070668_100001766 3300005347 Bacteria 15733
6 Ga0070668_100251899 3300005347 Bacteria 1466
7 Ga0070667_100315235 3300005367 Bacteria 1410
8 Ga0070700_100241588 3300005441 Bacteria 1291
9 Ga0070665_100066562 3300005548 Bacteria 3614
10 Ga0068855_100300366 3300005563 Bacteria 1778
11 Ga0068854_100011516 3300005578 Bacteria 5763
12 Ga0068859_100001577 3300005617 Bacteria 23231
13 Ga0068859_100347903 3300005617 Bacteria 1577
14 Ga0068863_100082615 3300005841 Bacteria 3045
15 Ga0068858_100041361 3300005842 Bacteria 4274
16 Ga0068862_100028370 3300005844 Bacteria 4713
17 Ga0081455_10006926 3300005937 Bacteria 12058
18 Ga0081539_10001722 3300005985 Bacteria 34982
19 Ga0081539_10002049 3300005985 Bacteria 30300
20 Ga0070717_10010030 3300006028 Bacteria 7131
21 Ga0097620_100001577 3300006931 Bacteria 23231
22 Ga0097620_100347935 3300006931 Bacteria 1577
23 Ga0099826_10087012 3300006948 Bacteria 1924
24 Ga0105240_10012382 3300009093 Bacteria 11779
25 Ga0105240_10045207 3300009093 Bacteria 5588
26 Ga0105240_10097272 3300009093 Bacteria 3587
27 Ga0105247_10005796 3300009101 Bacteria 7731
28 Ga0105241_10401345 3300009174 Bacteria 1202
29 Ga0105248_10106526 3300009177 Bacteria 3161
30 Ga0105237_10016459 3300009545 Bacteria 7681
31 Ga0105237_10495956 3300009545 Bacteria 1228
32 Ga0105238_10226776 3300009551 Bacteria 1845
33 Ga0105238_10265672 3300009551 Bacteria 1696
34 Ga0105239_10000164 3300010375 Bacteria 95286
35 Ga0157373_10002467 3300013100 Bacteria 14096
36 Ga0157370_10004389 3300013104 Bacteria 16192
37 Ga0157369_10005322 3300013105 Bacteria 14994
38 Ga0163163_10223274 3300014325 Bacteria 1933
39 Ga0157379_10012532 3300014968 Bacteria 7405
40 Ga0163161_10063653 3300017792 Bacteria 2689
41 Ga0213873_10004637 3300021358 Bacteria 2581
42 Ga0213876_10001227 3300021384 Bacteria 16194
43 Ga0213876_10003908 3300021384 Bacteria 8426
44 Ga0213876_10005321 3300021384 Bacteria 7081
45 Ga0213875_10003057 3300021388 Bacteria 9677
46 Ga0209050_1000776 3300025298 Bacteria 45644
47 Ga0209256_1000866 3300025299 Bacteria 37550
48 Ga0207426_1000092 3300025302 Bacteria 278907
49 Ga0207710_10019201 3300025900 Bacteria 2916
50 Ga0207695_10002727 3300025913 Bacteria 25767
51 Ga0207695_10103074 3300025913 Bacteria 2845
52 Ga0207671_10310033 3300025914 Bacteria 1247
53 Ga0207662_10094322 3300025918 Bacteria 1846
54 Ga0207694_10156721 3300025924 Bacteria 1837
55 Ga0207711_10153503 3300025941 Bacteria 2079
56 Ga0207689_10029318 3300025942 Bacteria 4596
57 Ga0207667_10253400 3300025949 Bacteria 1801
58 Ga0207668_10004450 3300025972 Bacteria 8232
59 Ga0207668_10248292 3300025972 Bacteria 1444
60 Ga0207658_10011740 3300025986 Bacteria 5966
61 Ga0207703_10048692 3300026035 Bacteria 3422
62 Ga0207708_10236033 3300026075 Bacteria 1469
63 Ga0268266_10002401 3300028379 Bacteria 20182
64 Ga0268266_10074550 3300028379 Bacteria 2947
65 Ga0268264_10053175 3300028381 Bacteria 3378
66 Ga0307515_10015266 3300028794 Bacteria 14164
67 Ga0307515_10022415 3300028794 Bacteria 11131
68 Ga0307515_10127954 3300028794 Bacteria 2821
69 Ga0307511_10000100 3300030521 Bacteria 75671
70 Ga0307511_10063921 3300030521 Bacteria 2773
71 Ga0307511_10065201 3300030521 Bacteria 2729
72 Ga0307512_10006160 3300030522 Bacteria 12256
73 Ga0307513_10001782 3300031456 Bacteria 30627
74 Ga0307513_10002978 3300031456 Bacteria 23090
75 Ga0307513_10116012 3300031456 Bacteria 2659
76 Ga0307513_10123156 3300031456 Bacteria 2555
77 Ga0307513_10238646 3300031456 Bacteria 1625
78 Ga0307509_10168497 3300031507 Bacteria 2074
79 Ga0307509_10251855 3300031507 Bacteria 1549
80 Ga0307508_10035206 3300031616 Bacteria 4513
81 Ga0316576_10111945 3300031727 Bacteria 2046
82 Ga0307516_10011435 3300031730 Bacteria 9642
83 Ga0307516_10058493 3300031730 Bacteria 3752
84 Ga0307405_10001490 3300031731 Bacteria 9900
85 Ga0307412_10092535 3300031911 Bacteria 2119
86 Ga0307416_100137758 3300032002 Bacteria 2212
87 Ga0307414_10163801 3300032004 Bacteria 1770
88 Ga0307507_10058130 3300033179 Bacteria 3634
89 Ga0307510_10000005 3300033180 Bacteria 633068
90 Ga0307510_10088398 3300033180 Bacteria 2958
91 Ga0373936_0000007 3300035113 Bacteria 290641
92 Ga0373936_0017026 3300035113 Bacteria 2795
93 Ga0395905_0118080 3300037471 Bacteria 2493
94 Ga0436364_1020870 3300037853 Bacteria 4078
95 Ga0436365_0260170 3300039437 Bacteria 52235
96 Ga0436365_0336706 3300039437 Bacteria 7082
97 Ga0436365_1132171 3300039437 Bacteria 10498
98 Ga0436362_0624758 3300039453 Bacteria 4681
99 Ga0439436_0021857 3300041404 Bacteria 1898
100 Ga0450907_007712 3300042146 Bacteria 1795
101 Ga0466966_0019686 3300044684 Bacteria 4440
102 Ga0495638_0017208 3300046460 Bacteria 4825
103 Ga0495584_0017053 3300046491 Bacteria 3702
104 Ga0495606_0095323 3300046507 Bacteria 1823
105 Ga0495610_0035765 3300046512 Bacteria 2545
106 Ga0495632_0000038 3300046519 Bacteria 155743
107 Ga0495637_0000061 3300046520 Bacteria 95460
108 Ga0495643_0000088 3300046522 Bacteria 155458
109 Ga0495663_0000013 3300046525 Bacteria 155493
110 Ga0495633_0000166 3300046558 Bacteria 86835
111 Ga0495633_0000471 3300046558 Bacteria 41052
112 Ga0495633_0034735 3300046558 Bacteria 2423
113 Ga0495668_0123935 3300046616 Bacteria 1414
114 Ga0495625_0000274 3300046660 Bacteria 80067
115 Ga0495625_0000884 3300046660 Bacteria 40584
116 Ga0495625_0002395 3300046660 Bacteria 20345
117 Ga0495625_0105010 3300046660 Bacteria 1936
118 Ga0495670_0007959 3300046691 Bacteria 5211
119 Ga0495671_0000048 3300046692 Bacteria 155712
120 Ga0495672_0059128 3300047320 Bacteria 2219
121 Ga0495681_0005188 3300047470 Bacteria 8759
122 Ga0495686_0000124 3300047472 Bacteria 159708
123 Ga0495686_0034667 3300047472 Bacteria 3249
124 Ga0495686_0126268 3300047472 Bacteria 1520
125 Ga0496105_0072023 3300048908 Bacteria 2856
126 Ga0496107_0142026 3300048910 Bacteria 1775
127 Ga0496108_0196642 3300048911 Bacteria 1749
128 Ga0496110_0025483 3300048913 Bacteria 5054
129 Ga0496111_0039340 3300048914 Bacteria 3390
130 Ga0496121_0000072 3300048924 Bacteria 244975
131 Ga0496121_0000587 3300048924 Bacteria 68273
132 Ga0496122_0001210 3300048925 Bacteria 43846
133 Ga0496126_0001309 3300048929 Bacteria 39651
134 Ga0496126_0021868 3300048929 Bacteria 6240
135 Ga0496126_0233460 3300048929 Bacteria 1540
136 Ga0501068_0131919 3300049584 Bacteria 1563
137 Ga0500578_0035848 3300053086 Bacteria 3188
138 Ga0500583_0010944 3300053092 Bacteria 3393
139 Ga0500583_0025260 3300053092 Bacteria 2534
140 Ga0500651_0000473 3300053093 Bacteria 21098
141 Ga0500566_0000424 3300053094 Bacteria 23525
142 Ga0500592_001096 3300053116 Bacteria 4415
143 Ga0500595_000115 3300053119 Bacteria 53482
144 Ga0500595_002776 3300053119 Bacteria 8438
145 Ga0500595_022893 3300053119 Bacteria 2202
146 Ga0500614_000138 3300053123 Bacteria 17937
147 Ga0500559_0005577 3300053136 Bacteria 5775
148 Ga0500585_014588 3300053144 Bacteria 2431
149 Ga0500622_0001852 3300053156 Bacteria 15996
150 Ga0500622_0004118 3300053156 Bacteria 9308
151 Ga0500622_0010592 3300053156 Bacteria 5054
152 Ga0500627_0000001 3300053158 Bacteria 251552
153 Ga0500636_0115692 3300053177 Bacteria 1510
154 Ga0500637_0072275 3300053178 Bacteria 1984
155 Ga0500645_003810 3300053730 Bacteria 5993

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10123156 Ga0307513_101231562 320
2 3300009545 Ga0105237_10495956 Ga0105237_104959562 326
3 3300009551 Ga0105238_10226776 Ga0105238_102267762 326
4 3300025914 Ga0207671_10310033 Ga0207671_103100332 326
5 3300025924 Ga0207694_10156721 Ga0207694_101567212 326
6 3300021384 Ga0213876_10005321 Ga0213876_100053212 328
7 3300030521 Ga0307511_10065201 Ga0307511_100652012 328
8 3300039437 Ga0436365_0336706 Ga0436365_0336706_3561_4625 328
9 3300032004 Ga0307414_10163801 Ga0307414_101638012 333
10 3300053092 Ga0500583_0010944 Ga0500583_0010944_1941_2945 334
11 3300003791 Ga0055530_10008514 Ga0055530_100085143 336
12 3300025298 Ga0209050_1000776 Ga0209050_100077613 336
13 3300046660 Ga0495625_0000884 Ga0495625_0000884_10255_11325 336
14 3300009177 Ga0105248_10106526 Ga0105248_101065262 340
15 3300025941 Ga0207711_10153503 Ga0207711_101535032 340
16 3300031730 Ga0307516_10011435 Ga0307516_100114352 341
17 3300046691 Ga0495670_0007959 Ga0495670_0007959_717_1778 342
18 3300028794 Ga0307515_10015266 Ga0307515_100152667 343
19 3300031456 Ga0307513_10002978 Ga0307513_1000297812 344
20 3300031507 Ga0307509_10168497 Ga0307509_101684972 344
21 3300048929 Ga0496126_0233460 Ga0496126_0233460_177_1262 344
22 iso_pu_bacteria 2898795034 2898796028 344
23 3300005441 Ga0070700_100241588 Ga0070700_1002415882 345
24 3300026075 Ga0207708_10236033 Ga0207708_102360331 345
25 3300031616 Ga0307508_10035206 Ga0307508_100352063 345
26 3300033179 Ga0307507_10058130 Ga0307507_100581303 345
27 3300053094 Ga0500566_0000424 Ga0500566_0000424_747_1877 345
28 3300053116 Ga0500592_001096 Ga0500592_001096_1640_2680 345
29 3300053119 Ga0500595_000115 Ga0500595_000115_48583_49713 345
30 3300053123 Ga0500614_000138 Ga0500614_000138_7566_8696 345
31 3300053136 Ga0500559_0005577 Ga0500559_0005577_2337_3467 345
32 3300053144 Ga0500585_014588 Ga0500585_014588_1010_2140 345
33 3300053158 Ga0500627_0000001 Ga0500627_0000001_50593_51633 345
34 3300005334 Ga0068869_100021805 Ga0068869_1000218053 346
35 3300005617 Ga0068859_100347903 Ga0068859_1003479032 346
36 3300006931 Ga0097620_100347935 Ga0097620_1003479352 346
37 3300025918 Ga0207662_10094322 Ga0207662_100943222 346
38 3300025942 Ga0207689_10029318 Ga0207689_100293182 346
39 3300035113 Ga0373936_0000007 Ga0373936_0000007_213869_215002 346
40 3300044684 Ga0466966_0019686 Ga0466966_0019686_773_1888 347
41 3300006948 Ga0099826_10087012 Ga0099826_100870123 348
42 3300021388 Ga0213875_10003057 Ga0213875_100030573 348
43 3300031911 Ga0307412_10092535 Ga0307412_100925352 348
44 3300037853 Ga0436364_1020870 Ga0436364_1020870_1172_2281 348
45 iso_pu_bacteria 2554235003 2554249097 348
46 iso_pu_bacteria 2919166419 2919170746 348
47 3300005578 Ga0068854_100011516 Ga0068854_1000115162 349
48 3300021358 Ga0213873_10004637 Ga0213873_100046374 349
49 3300021384 Ga0213876_10001227 Ga0213876_100012274 349
50 3300039437 Ga0436365_1132171 Ga0436365_1132171_8485_9594 349
51 3300039453 Ga0436362_0624758 Ga0436362_0624758_2943_4052 349
52 3300005563 Ga0068855_100300366 Ga0068855_1003003662 350
53 3300005844 Ga0068862_100028370 Ga0068862_1000283704 350
54 3300009093 Ga0105240_10012382 Ga0105240_100123827 350
55 3300009093 Ga0105240_10097272 Ga0105240_100972724 350
56 3300009545 Ga0105237_10016459 Ga0105237_100164592 350
57 3300010375 Ga0105239_10000164 Ga0105239_1000016479 350
58 3300025913 Ga0207695_10002727 Ga0207695_1000272713 350
59 3300025913 Ga0207695_10103074 Ga0207695_101030744 350
60 3300025949 Ga0207667_10253400 Ga0207667_102534002 350
61 3300028379 Ga0268266_10002401 Ga0268266_1000240113 350
62 3300033180 Ga0307510_10000005 Ga0307510_10000005281 350
63 3300033180 Ga0307510_10088398 Ga0307510_100883983 350
64 3300035113 Ga0373936_0017026 Ga0373936_0017026_443_1510 350
65 3300046507 Ga0495606_0095323 Ga0495606_0095323_356_1411 350
66 3300046660 Ga0495625_0000274 Ga0495625_0000274_25018_26070 350
67 3300046660 Ga0495625_0105010 Ga0495625_0105010_535_1632 350
68 3300048924 Ga0496121_0000072 Ga0496121_0000072_111207_112340 350
69 3300048924 Ga0496121_0000587 Ga0496121_0000587_24775_25830 350
70 3300048929 Ga0496126_0021868 Ga0496126_0021868_4299_5432 350
71 iso_pu_bacteria 2821443989 2821449805 350
72 iso_pu_bacteria 2842871566 2842874986 350
73 3300030521 Ga0307511_10063921 Ga0307511_100639212 351
74 3300031456 Ga0307513_10116012 Ga0307513_101160122 351
75 3300037471 Ga0395905_0118080 Ga0395905_0118080_123_1208 351
76 3300046491 Ga0495584_0017053 Ga0495584_0017053_338_1393 351
77 3300046519 Ga0495632_0000038 Ga0495632_0000038_69745_70800 351
78 3300046520 Ga0495637_0000061 Ga0495637_0000061_52788_53843 351
79 3300046522 Ga0495643_0000088 Ga0495643_0000088_84494_85549 351
80 3300046525 Ga0495663_0000013 Ga0495663_0000013_84837_85892 351
81 3300046558 Ga0495633_0000166 Ga0495633_0000166_56211_57266 351
82 3300046558 Ga0495633_0000471 Ga0495633_0000471_10144_11199 351
83 3300046558 Ga0495633_0034735 Ga0495633_0034735_250_1305 351
84 3300046616 Ga0495668_0123935 Ga0495668_0123935_226_1281 351
85 3300046692 Ga0495671_0000048 Ga0495671_0000048_84621_85676 351
86 3300047470 Ga0495681_0005188 Ga0495681_0005188_7297_8352 351
87 3300047472 Ga0495686_0126268 Ga0495686_0126268_202_1257 351
88 3300053119 Ga0500595_002776 Ga0500595_002776_439_1524 351
89 3300053119 Ga0500595_022893 Ga0500595_022893_837_1892 351
90 3300013100 Ga0157373_10002467 Ga0157373_1000246712 352
91 3300013104 Ga0157370_10004389 Ga0157370_1000438915 352
92 3300013105 Ga0157369_10005322 Ga0157369_100053226 352
93 3300017792 Ga0163161_10063653 Ga0163161_100636532 352
94 3300031731 Ga0307405_10001490 Ga0307405_100014908 352
95 3300048925 Ga0496122_0001210 Ga0496122_0001210_1258_2316 352
96 3300009174 Ga0105241_10401345 Ga0105241_104013451 353
97 3300025302 Ga0207426_1000092 Ga0207426_1000092153 353
98 3300031730 Ga0307516_10058493 Ga0307516_100584933 353
99 3300041404 Ga0439436_0021857 Ga0439436_0021857_338_1399 353
100 3300042146 Ga0450907_007712 Ga0450907_007712_283_1344 353
101 3300046512 Ga0495610_0035765 Ga0495610_0035765_1239_2300 353
102 iso_pu_bacteria 2508501050 2508730068 353
103 iso_pu_bacteria 2582581294 2585200467 353
104 iso_pu_bacteria 2643221734 2644734156 353
105 iso_pu_bacteria 2773857925 2774873241 353
106 iso_pu_bacteria 2808606387 2808990061 353
107 iso_pu_bacteria 2935648319 2935651751 353
108 iso_pu_bacteria 2935656913 2935660561 353
109 iso_pu_bacteria 2936011229 2936014617 353
110 iso_pu_bacteria 2936019824 2936023587 353
111 iso_pu_bacteria 2936028420 2936032615 353
112 iso_pu_bacteria 2936046547 2936050358 353
113 iso_pu_bacteria 2936055302 2936059150 353
114 iso_pu_bacteria 2989349275 2989353570 353
115 iso_pu_bacteria 8016630954 8016631889 353
116 3300005347 Ga0070668_100001766 Ga0070668_1000017666 354
117 3300005548 Ga0070665_100066562 Ga0070665_1000665622 354
118 3300025972 Ga0207668_10004450 Ga0207668_100044506 354
119 3300028379 Ga0268266_10074550 Ga0268266_100745502 354
120 3300028794 Ga0307515_10127954 Ga0307515_101279542 354
121 3300031456 Ga0307513_10238646 Ga0307513_102386462 354
122 3300047320 Ga0495672_0059128 Ga0495672_0059128_792_1856 354
123 3300047472 Ga0495686_0034667 Ga0495686_0034667_2148_3224 354
124 3300053156 Ga0500622_0001852 Ga0500622_0001852_4215_5279 354
125 3300053156 Ga0500622_0004118 Ga0500622_0004118_701_1765 354
126 3300053156 Ga0500622_0010592 Ga0500622_0010592_562_1626 354
127 3300053730 Ga0500645_003810 Ga0500645_003810_2049_3113 354
128 3300005347 Ga0070668_100251899 Ga0070668_1002518991 355
129 3300025972 Ga0207668_10248292 Ga0207668_102482922 355
130 3300028794 Ga0307515_10022415 Ga0307515_100224159 355
131 3300053092 Ga0500583_0025260 Ga0500583_0025260_230_1297 355
132 iso_pu_bacteria 2643221610 2644064533 355
133 iso_pu_bacteria 2643221675 2644419586 355
134 iso_pu_bacteria 2643221680 2644452943 355
135 iso_pu_bacteria 2643221726 2644691934 355
136 iso_pu_bacteria 2791355091 2792619813 355
137 iso_pu_bacteria 2791355261 2793326113 355
138 iso_pu_bacteria 3003930520 3003934287 355
139 iso_pu_bacteria 8005382845 8005387250 355
140 3300003203 JGI25406J46586_10042627 JGI25406J46586_100426271 356
141 3300005985 Ga0081539_10001722 Ga0081539_1000172222 356
142 3300030522 Ga0307512_10006160 Ga0307512_100061606 356
143 3300031456 Ga0307513_10001782 Ga0307513_1000178220 356
144 3300003203 JGI25406J46586_10022949 JGI25406J46586_100229493 357
145 3300005367 Ga0070667_100315235 Ga0070667_1003152351 357
146 3300005617 Ga0068859_100001577 Ga0068859_10000157717 357
147 3300005841 Ga0068863_100082615 Ga0068863_1000826152 357
148 3300005842 Ga0068858_100041361 Ga0068858_1000413612 357
149 3300005937 Ga0081455_10006926 Ga0081455_100069268 357
150 3300005985 Ga0081539_10002049 Ga0081539_1000204912 357
151 3300006028 Ga0070717_10010030 Ga0070717_100100304 357
152 3300006931 Ga0097620_100001577 Ga0097620_10000157717 357
153 3300009093 Ga0105240_10045207 Ga0105240_100452073 357
154 3300009101 Ga0105247_10005796 Ga0105247_100057963 357
155 3300009551 Ga0105238_10265672 Ga0105238_102656722 357
156 3300014325 Ga0163163_10223274 Ga0163163_102232742 357
157 3300014968 Ga0157379_10012532 Ga0157379_100125325 357
158 3300021384 Ga0213876_10003908 Ga0213876_100039083 357
159 3300025299 Ga0209256_1000866 Ga0209256_100086624 357
160 3300025900 Ga0207710_10019201 Ga0207710_100192014 357
161 3300025986 Ga0207658_10011740 Ga0207658_100117402 357
162 3300026035 Ga0207703_10048692 Ga0207703_100486924 357
163 3300028381 Ga0268264_10053175 Ga0268264_100531752 357
164 3300030521 Ga0307511_10000100 Ga0307511_1000010021 357
165 3300031507 Ga0307509_10251855 Ga0307509_102518552 357
166 3300031727 Ga0316576_10111945 Ga0316576_101119451 357
167 3300032002 Ga0307416_100137758 Ga0307416_1001377582 357
168 3300039437 Ga0436365_0260170 Ga0436365_0260170_32913_34025 357
169 3300046460 Ga0495638_0017208 Ga0495638_0017208_946_2028 357
170 3300046660 Ga0495625_0002395 Ga0495625_0002395_13277_14437 357
171 3300047472 Ga0495686_0000124 Ga0495686_0000124_13947_15044 357
172 3300048908 Ga0496105_0072023 Ga0496105_0072023_1344_2456 357
173 3300048910 Ga0496107_0142026 Ga0496107_0142026_209_1327 357
174 3300048911 Ga0496108_0196642 Ga0496108_0196642_149_1261 357
175 3300048913 Ga0496110_0025483 Ga0496110_0025483_1316_2428 357
176 3300048914 Ga0496111_0039340 Ga0496111_0039340_1514_2626 357
177 3300048929 Ga0496126_0001309 Ga0496126_0001309_21291_22367 357
178 3300049584 Ga0501068_0131919 Ga0501068_0131919_276_1394 357
179 3300053086 Ga0500578_0035848 Ga0500578_0035848_357_1442 357
180 3300053093 Ga0500651_0000473 Ga0500651_0000473_10226_11311 357
181 3300053177 Ga0500636_0115692 Ga0500636_0115692_241_1317 357
182 3300053178 Ga0500637_0072275 Ga0500637_0072275_522_1604 357
183 iso_pu_bacteria 2919450847 2919455725 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

38

383

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wpw-assembly1.cif.gz_A crystal structure of ipmdh from sulfolobus tokodaii 0.9258 2 351
1x0l-assembly1.cif.gz_B-2 crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, thermus thermophilus 0.92 2 353
1wpw-assembly1.cif.gz_A crystal structure of ipmdh from sulfolobus tokodaii 0.9152 2 351
1x0l-assembly1.cif.gz_B-2 crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, thermus thermophilus 0.9091 2 353
4y1p-assembly1.cif.gz_B-2 crystal structure of 3-isopropylmalate dehydrogenase (saci_0600) from sulfolobus acidocaldarius complex with 3-isopropylmalate and mg2+ 0.9058 2 350
ID Description Score Start End Superfamily
1wpwB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.927 2 351 3.40.718.10
1x0lB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.92 2 353 3.40.718.10
1wpwB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9165 2 351 3.40.718.10
1x0lB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9091 2 353 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.893 2 353 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A537KXX4-F1-model_v4 Isocitrate/isopropylmalate dehydrogenase family protein 0.9747 228 352 GO:0000287
GO:0004449
GO:0006099
GO:0006102
GO:0051287
AF-A0A158M949-F1-model_v4 3-isopropylmalate dehydrogenase domain protein 0.968 1 97 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A3C0CXA8-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9642 152 252 GO:0000287
GO:0003862
GO:0051287
AF-A0A150K1N5-F1-model_v4 deleted 0.9529 143 354
AF-A0A537KXX4-F1-model_v4 Isocitrate/isopropylmalate dehydrogenase family protein 0.9523 228 352 GO:0000287
GO:0004449
GO:0006099
GO:0006102
GO:0051287

Feature Viewer

pLDDT pTM Quality
90.09 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map