F281536

General Info

Members Datasets Scaffolds Average Seq Length
183 119 366 281

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0148036|Ga0501068_0148036_452_1327
Length 291
Sequence MTKLITEDDVVGELRDGMTIGFGGWGSRRKPMSLVRAIARSSLKDLTVVSYGGPDVGILCAAGKVKKVVYSFCSLDSIALEPHFRKARQAGTIDTLELDEGMFLLGLQAAAWRVPFLPTRVGLGSDVLERQRDQIKTVRSPYDDGEELVAAPALNLDVALVHMHRGDARGNGQYLNVDPYFDDLFCMAAPKAFMSVEQVQDTDDLRSNGAVQTMRINRLMTAGVVEAPHGAHFTECVPDYARDEAFQKEYAASAKSDEAWAAWKDKYVDCGGHDEYRKVAGLSGPERGRGL

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
4 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
5 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
31 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
32 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
49 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
50 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
51 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
52 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
109 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
112 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
118 2582580736 Prauserella sp. Am3 Isolate Unclassified
119 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 10.38
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0148036 3300049584 Bacteria 1474
2 Ga0070680_100000063 3300005336 Bacteria 55957
3 Ga0070680_100382222 3300005336 Bacteria 1199
4 Ga0070681_10000060 3300005458 Bacteria 78566
5 Ga0070679_100000048 3300005530 Bacteria 89533
6 Ga0070696_100452919 3300005546 Bacteria 1013
7 Ga0081455_10054664 3300005937 Bacteria 3401
8 Ga0075365_10067708 3300006038 Bacteria 2397
9 Ga0070712_100304668 3300006175 Bacteria 1290
10 Ga0075435_100071986 3300007076 Bacteria 2824
11 Ga0105245_10014823 3300009098 Bacteria 6790
12 Ga0105243_10094016 3300009148 Bacteria 2475
13 Ga0105237_10304726 3300009545 Bacteria 1596
14 Ga0105246_10244368 3300011119 Bacteria 1421
15 Ga0157373_10096839 3300013100 Bacteria 2077
16 Ga0157369_10118964 3300013105 Bacteria 2804
17 Ga0157378_10389469 3300013297 Bacteria 1370
18 Ga0157372_10824184 3300013307 Bacteria 1077
19 Ga0213876_10002138 3300021384 Bacteria 11683
20 Ga0213871_10019135 3300021441 Bacteria 1683
21 Ga0207692_10139557 3300025898 Bacteria 1378
22 Ga0207707_10000185 3300025912 Bacteria 65663
23 Ga0207693_10355784 3300025915 Bacteria 1146
24 Ga0207663_10103451 3300025916 Bacteria 1918
25 Ga0207660_10001440 3300025917 Bacteria 15976
26 Ga0207652_10000575 3300025921 Bacteria 36922
27 Ga0207686_10152335 3300025934 Bacteria 1611
28 Ga0207665_10319926 3300025939 Bacteria 1164
29 Ga0207661_10258622 3300025944 Bacteria 1550
30 Ga0265338_10001030 3300028800 Bacteria 46656
31 Ga0265338_10022670 3300028800 Bacteria 6487
32 Ga0265338_10120937 3300028800 Bacteria 2087
33 Ga0265338_10121951 3300028800 Bacteria 2076
34 Ga0307512_10021058 3300030522 Bacteria 5887
35 Ga0265332_10000314 3300031238 Bacteria 37122
36 Ga0265328_10010444 3300031239 Bacteria 3737
37 Ga0265320_10021134 3300031240 Bacteria 3509
38 Ga0265325_10000193 3300031241 Bacteria 43575
39 Ga0265325_10001948 3300031241 Bacteria 14229
40 Ga0265329_10003469 3300031242 Bacteria 6859
41 Ga0265329_10015387 3300031242 Bacteria 2672
42 Ga0265340_10000075 3300031247 Bacteria 47375
43 Ga0265340_10180978 3300031247 Bacteria 953
44 Ga0265339_10001575 3300031249 Bacteria 16860
45 Ga0265339_10004055 3300031249 Bacteria 10116
46 Ga0265339_10087628 3300031249 Bacteria 1636
47 Ga0265331_10000064 3300031250 Bacteria 165231
48 Ga0265327_10002899 3300031251 Bacteria 17219
49 Ga0265327_10027128 3300031251 Bacteria 3302
50 Ga0265316_10000421 3300031344 Bacteria 48310
51 Ga0265313_10000380 3300031595 Bacteria 47957
52 Ga0265313_10014943 3300031595 Bacteria 4555
53 Ga0265313_10078955 3300031595 Bacteria 1499
54 Ga0265314_10000110 3300031711 Bacteria 124924
55 Ga0265314_10026180 3300031711 Bacteria 4386
56 Ga0265314_10029766 3300031711 Bacteria 4054
57 Ga0265342_10010748 3300031712 Bacteria 6318
58 Ga0265342_10157909 3300031712 Bacteria 1255
59 Ga0307518_10041336 3300031838 Bacteria 3356
60 Ga0373937_0086282 3300036401 Bacteria 2905
61 Ga0373937_0554963 3300036401 Bacteria 1091
62 Ga0373937_0634073 3300036401 Bacteria 1014
63 Ga0373925_0477262 3300037068 Bacteria 1023
64 Ga0436365_0229625 3300039437 Bacteria 76076
65 Ga0436360_0487802 3300039438 Bacteria 3972
66 Ga0436361_0992401 3300039447 Bacteria 3053
67 Ga0436363_1552456 3300039450 Bacteria 1006
68 Ga0436362_0561730 3300039453 Bacteria 9368
69 Ga0436362_1057495 3300039453 Bacteria 2466
70 Ga0439434_0014726 3300042435 Bacteria 2328
71 Ga0466972_0018723 3300044658 Bacteria 3462
72 Ga0466961_0034132 3300044693 Bacteria 3267
73 Ga0466961_0038192 3300044693 Bacteria 3080
74 Ga0466963_0007783 3300044694 Bacteria 6406
75 Ga0466963_0040791 3300044694 Bacteria 3043
76 Ga0466963_0043325 3300044694 Bacteria 2959
77 Ga0466963_0404764 3300044694 Bacteria 962
78 Ga0466964_0036257 3300044706 Bacteria 1977
79 Ga0466971_0005614 3300044719 Bacteria 5455
80 Ga0466970_0083204 3300044765 Bacteria 1732
81 Ga0466957_0005107 3300044842 Bacteria 7333
82 Ga0466959_0029131 3300045049 Bacteria 4091
83 Ga0466958_0007162 3300045836 Bacteria 6115
84 Ga0466958_0027437 3300045836 Bacteria 3370
85 Ga0466958_0121890 3300045836 Bacteria 1633
86 Ga0466958_0133452 3300045836 Bacteria 1560
87 Ga0466967_0026693 3300045976 Bacteria 4789
88 Ga0466967_0202241 3300045976 Bacteria 1882
89 Ga0495629_0179059 3300046459 Bacteria 1470
90 Ga0495629_0205800 3300046459 Bacteria 1360
91 Ga0495628_0438594 3300046516 Bacteria 950
92 Ga0495630_0382392 3300046517 Bacteria 1078
93 Ga0495640_0159244 3300046533 Bacteria 1448
94 Ga0495667_0059820 3300046559 Bacteria 2500
95 Ga0495634_0104906 3300046642 Bacteria 1823
96 Ga0495657_0312455 3300046675 Bacteria 935
97 Ga0495657_0380590 3300046675 Bacteria 832
98 Ga0495624_0117610 3300046690 Bacteria 1633
99 Ga0495674_0660458 3300047319 Bacteria 824
100 Ga0495676_0085120 3300047321 Bacteria 2383
101 Ga0495680_0021375 3300047322 Bacteria 5419
102 Ga0495684_0120646 3300047471 Bacteria 1975
103 Ga0496100_0029366 3300048903 Bacteria 3400
104 Ga0496101_0036990 3300048904 Bacteria 3460
105 Ga0496102_0035013 3300048905 Bacteria 4519
106 Ga0496102_0234678 3300048905 Bacteria 1729
107 Ga0496103_0343368 3300048906 Bacteria 960
108 Ga0496104_0039672 3300048907 Bacteria 4409
109 Ga0496105_0032955 3300048908 Bacteria 4253
110 Ga0496105_0177125 3300048908 Bacteria 1746
111 Ga0496108_0018278 3300048911 Bacteria 5740
112 Ga0496109_0001537 3300048912 Bacteria 19187
113 Ga0496110_0131154 3300048913 Bacteria 2263
114 Ga0496110_0403582 3300048913 Bacteria 1246
115 Ga0496111_0031476 3300048914 Bacteria 3779
116 Ga0496111_0371519 3300048914 Bacteria 1058
117 Ga0496112_0010232 3300048915 Bacteria 8502
118 Ga0496112_0276968 3300048915 Bacteria 1625
119 Ga0496113_0015332 3300048916 Bacteria 5264
120 Ga0496114_0368079 3300048917 Bacteria 1272
121 Ga0496115_0004635 3300048918 Bacteria 9948
122 Ga0501034_0002414 3300049571 Bacteria 22623
123 Ga0501034_0250407 3300049571 Bacteria 1716
124 Ga0501037_0034943 3300049573 Bacteria 3708
125 Ga0501037_0322575 3300049573 Bacteria 1069
126 Ga0501043_0042660 3300049579 Bacteria 3565
127 Ga0501067_0022440 3300049583 Bacteria 3493
128 Ga0501068_0007232 3300049584 Bacteria 6145
129 Ga0501069_0006270 3300049585 Bacteria 6218
130 Ga0501069_0011872 3300049585 Bacteria 4619
131 Ga0501070_0001268 3300049586 Bacteria 22674
132 Ga0501070_0001734 3300049586 Bacteria 19273
133 Ga0501070_0004650 3300049586 Bacteria 11756
134 Ga0501070_0010529 3300049586 Bacteria 7819
135 Ga0501070_0022380 3300049586 Bacteria 5294
136 Ga0501070_0054853 3300049586 Bacteria 3305
137 Ga0501071_0034309 3300049587 Bacteria 3610
138 Ga0501072_0002546 3300049588 Bacteria 13662
139 Ga0501072_0073444 3300049588 Bacteria 2704
140 Ga0501073_0002927 3300049589 Bacteria 12809
141 Ga0501073_0074654 3300049589 Bacteria 2361
142 Ga0501074_0012152 3300049590 Bacteria 6260
143 Ga0501074_0026912 3300049590 Bacteria 4168
144 Ga0501074_0032324 3300049590 Bacteria 3791
145 Ga0501074_0094281 3300049590 Bacteria 2144
146 Ga0501076_0013218 3300049592 Bacteria 6187
147 Ga0501079_0042022 3300049741 Bacteria 3530
148 Ga0501079_0051809 3300049741 Bacteria 3170
149 Ga0501080_0001406 3300049742 Bacteria 20162
150 Ga0501080_0002610 3300049742 Bacteria 15781
151 Ga0501080_0004180 3300049742 Bacteria 12801
152 Ga0501080_0020653 3300049742 Bacteria 6100
153 Ga0501080_0043519 3300049742 Bacteria 4181
154 Ga0501080_0364154 3300049742 Bacteria 1304
155 Ga0501083_0003829 3300049744 Bacteria 10566
156 Ga0501083_0006046 3300049744 Bacteria 8573
157 Ga0501083_0091623 3300049744 Bacteria 2007
158 Ga0501044_0068664 3300049823 Bacteria 3610
159 nmdc:mga00v17_243773_c1 3300050491 Bacteria 1165
160 nmdc:mga0qj67_466619_c1 3300050509 Bacteria 1016
161 nmdc:mga06r32_593825_c1 3300050510 Bacteria 1078
162 nmdc:mga0n895_343304_c1 3300050512 Bacteria 1512
163 nmdc:mga0n895_459975_c1 3300050512 Bacteria 1284
164 Ga0495601_0041825 3300053077 Bacteria 2874
165 Ga0495601_0049609 3300053077 Bacteria 2647
166 Ga0495601_0176200 3300053077 Bacteria 1398
167 Ga0495612_0004424 3300053078 Bacteria 5827
168 Ga0495612_0099602 3300053078 Bacteria 1237
169 Ga0495619_0114495 3300053085 Bacteria 1845
170 Ga0495619_0212767 3300053085 Bacteria 1339
171 Ga0495619_0234338 3300053085 Bacteria 1272
172 Ga0500573_0006388 3300053140 Bacteria 6375
173 Ga0500577_0011073 3300053142 Bacteria 2678
174 Ga0500616_0003641 3300053153 Bacteria 11587
175 Ga0501084_0000010 3300054114 Bacteria 187712
176 Ga0501084_0005928 3300054114 Bacteria 10065
177 Ga0501084_0210010 3300054114 Bacteria 1643
178 Ga0501082_0250808 3300060353 Bacteria 1540
179 Ga0466962_0006524 3300061719 Bacteria 5601
180 Ga0466962_0034226 3300061719 Bacteria 2432
181 Ga0530510_0024630 3300061734 Bacteria 4297
182 2583153173 2582580736 Bacteria 5325865
183 2676495617 2675903060 Bacteria 10051191
184 Ga0501068_0148036
185 Ga0070680_100000063
186 Ga0070680_100382222
187 Ga0070681_10000060
188 Ga0070679_100000048
189 Ga0070696_100452919
190 Ga0081455_10054664
191 Ga0075365_10067708
192 Ga0070712_100304668
193 Ga0075435_100071986
194 Ga0105245_10014823
195 Ga0105243_10094016
196 Ga0105237_10304726
197 Ga0105246_10244368
198 Ga0157373_10096839
199 Ga0157369_10118964
200 Ga0157378_10389469
201 Ga0157372_10824184
202 Ga0213876_10002138
203 Ga0213871_10019135
204 Ga0207692_10139557
205 Ga0207707_10000185
206 Ga0207693_10355784
207 Ga0207663_10103451
208 Ga0207660_10001440
209 Ga0207652_10000575
210 Ga0207686_10152335
211 Ga0207665_10319926
212 Ga0207661_10258622
213 Ga0265338_10001030
214 Ga0265338_10022670
215 Ga0265338_10120937
216 Ga0265338_10121951
217 Ga0307512_10021058
218 Ga0265332_10000314
219 Ga0265328_10010444
220 Ga0265320_10021134
221 Ga0265325_10000193
222 Ga0265325_10001948
223 Ga0265329_10003469
224 Ga0265329_10015387
225 Ga0265340_10000075
226 Ga0265340_10180978
227 Ga0265339_10001575
228 Ga0265339_10004055
229 Ga0265339_10087628
230 Ga0265331_10000064
231 Ga0265327_10002899
232 Ga0265327_10027128
233 Ga0265316_10000421
234 Ga0265313_10000380
235 Ga0265313_10014943
236 Ga0265313_10078955
237 Ga0265314_10000110
238 Ga0265314_10026180
239 Ga0265314_10029766
240 Ga0265342_10010748
241 Ga0265342_10157909
242 Ga0307518_10041336
243 Ga0373937_0086282
244 Ga0373937_0554963
245 Ga0373937_0634073
246 Ga0373925_0477262
247 Ga0436365_0229625
248 Ga0436360_0487802
249 Ga0436361_0992401
250 Ga0436363_1552456
251 Ga0436362_0561730
252 Ga0436362_1057495
253 Ga0439434_0014726
254 Ga0466972_0018723
255 Ga0466961_0034132
256 Ga0466961_0038192
257 Ga0466963_0007783
258 Ga0466963_0040791
259 Ga0466963_0043325
260 Ga0466963_0404764
261 Ga0466964_0036257
262 Ga0466971_0005614
263 Ga0466970_0083204
264 Ga0466957_0005107
265 Ga0466959_0029131
266 Ga0466958_0007162
267 Ga0466958_0027437
268 Ga0466958_0121890
269 Ga0466958_0133452
270 Ga0466967_0026693
271 Ga0466967_0202241
272 Ga0495629_0179059
273 Ga0495629_0205800
274 Ga0495628_0438594
275 Ga0495630_0382392
276 Ga0495640_0159244
277 Ga0495667_0059820
278 Ga0495634_0104906
279 Ga0495657_0312455
280 Ga0495657_0380590
281 Ga0495624_0117610
282 Ga0495674_0660458
283 Ga0495676_0085120
284 Ga0495680_0021375
285 Ga0495684_0120646
286 Ga0496100_0029366
287 Ga0496101_0036990
288 Ga0496102_0035013
289 Ga0496102_0234678
290 Ga0496103_0343368
291 Ga0496104_0039672
292 Ga0496105_0032955
293 Ga0496105_0177125
294 Ga0496108_0018278
295 Ga0496109_0001537
296 Ga0496110_0131154
297 Ga0496110_0403582
298 Ga0496111_0031476
299 Ga0496111_0371519
300 Ga0496112_0010232
301 Ga0496112_0276968
302 Ga0496113_0015332
303 Ga0496114_0368079
304 Ga0496115_0004635
305 Ga0501034_0002414
306 Ga0501034_0250407
307 Ga0501037_0034943
308 Ga0501037_0322575
309 Ga0501043_0042660
310 Ga0501067_0022440
311 Ga0501068_0007232
312 Ga0501069_0006270
313 Ga0501069_0011872
314 Ga0501070_0001268
315 Ga0501070_0001734
316 Ga0501070_0004650
317 Ga0501070_0010529
318 Ga0501070_0022380
319 Ga0501070_0054853
320 Ga0501071_0034309
321 Ga0501072_0002546
322 Ga0501072_0073444
323 Ga0501073_0002927
324 Ga0501073_0074654
325 Ga0501074_0012152
326 Ga0501074_0026912
327 Ga0501074_0032324
328 Ga0501074_0094281
329 Ga0501076_0013218
330 Ga0501079_0042022
331 Ga0501079_0051809
332 Ga0501080_0001406
333 Ga0501080_0002610
334 Ga0501080_0004180
335 Ga0501080_0020653
336 Ga0501080_0043519
337 Ga0501080_0364154
338 Ga0501083_0003829
339 Ga0501083_0006046
340 Ga0501083_0091623
341 Ga0501044_0068664
342 nmdc:mga00v17_243773_c1
343 nmdc:mga0qj67_466619_c1
344 nmdc:mga06r32_593825_c1
345 nmdc:mga0n895_343304_c1
346 nmdc:mga0n895_459975_c1
347 Ga0495601_0041825
348 Ga0495601_0049609
349 Ga0495601_0176200
350 Ga0495612_0004424
351 Ga0495612_0099602
352 Ga0495619_0114495
353 Ga0495619_0212767
354 Ga0495619_0234338
355 Ga0500573_0006388
356 Ga0500577_0011073
357 Ga0500616_0003641
358 Ga0501084_0000010
359 Ga0501084_0005928
360 Ga0501084_0210010
361 Ga0501082_0250808
362 Ga0466962_0006524
363 Ga0466962_0034226
364 Ga0530510_0024630
365 2583153173
366 2676495617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

227

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.9695 2 281
6con-assembly2.cif.gz_G crystal structure of mycobacterium tuberculosis ipdab 0.9692 1 281
6coj-assembly1.cif.gz_A-2 crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex 0.9688 2 281
6con-assembly2.cif.gz_G crystal structure of mycobacterium tuberculosis ipdab 0.9625 1 281
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.9595 2 281
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9168 4 279 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8665 2 225 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8552 2 225 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8514 3 226 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8413 7 226 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A258X2E0-F1-model_v4 Acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha 0.9849 6 118 GO:0008410
AF-A0A7V9C0Q4-F1-model_v4 CoA transferase subunit A 0.9848 1 280 GO:0008410
AF-A0A7C2NE79-F1-model_v4 CoA transferase subunit A 0.9844 3 281 GO:0008410
AF-A0A660CME6-F1-model_v4 Acyl CoA:acetate/3-ketoacid CoA transferase alpha subunit 0.9821 1 281 GO:0008410
AF-A0A2W5ZDJ9-F1-model_v4 Acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha 0.9818 26 282 GO:0008410

Map