F281294

General Info

Members Datasets Scaffolds Average Seq Length
183 114 366 81

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0071680|Ga0451576_0071680_283_555
Length 90
Sequence MQAFLEYVVKGLVKNPEQVTITPVDRSGMTVYELRMDPADVGRVIGRQGMTINAIRSLLTAGSARKGLRCSLEIVEDKPADDRPEEPPAS

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
75 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
82 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
107 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 2.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.55
Rhizosphere 98.36
Stem 0
Stem Tuber 0
Unclassified 31.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0071680 3300045051 Bacteria 3607
2 Ga0006770J48903_1046809 3300003305 Bacteria 797
3 Ga0070683_101691275 3300005329 Bacteria 608
4 Ga0070690_100002523 3300005330 Bacteria 9846
5 Ga0070690_100409067 3300005330 Bacteria 998
6 Ga0070690_100834274 3300005330 Bacteria 717
7 Ga0068868_101342923 3300005338 Bacteria 665
8 Ga0070689_100009574 3300005340 Bacteria 6873
9 Ga0070689_101924835 3300005340 Unclassified 540
10 Ga0070674_101752306 3300005356 Unclassified 562
11 Ga0070688_100037434 3300005365 Bacteria 2956
12 Ga0070688_100404332 3300005365 Bacteria 1011
13 Ga0070713_100096526 3300005436 Bacteria 2552
14 Ga0070711_100567494 3300005439 Bacteria 943
15 Ga0070705_100309853 3300005440 Bacteria 1135
16 Ga0070705_100423442 3300005440 Bacteria 992
17 Ga0070705_101028162 3300005440 Bacteria 670
18 Ga0070708_102045644 3300005445 Unclassified 530
19 Ga0070707_102131553 3300005468 Unclassified 528
20 Ga0070686_100287404 3300005544 Bacteria 1215
21 Ga0070704_100163632 3300005549 Bacteria 1762
22 Ga0070704_100711342 3300005549 Unclassified 892
23 Ga0068855_100879064 3300005563 Unclassified 948
24 Ga0068859_100486619 3300005617 Unclassified 1329
25 Ga0068859_102499941 3300005617 Bacteria 569
26 Ga0068864_100039396 3300005618 Bacteria 4039
27 Ga0068866_11227909 3300005718 Bacteria 542
28 Ga0068863_100092812 3300005841 Unclassified 2865
29 Ga0068860_102425938 3300005843 Unclassified 544
30 Ga0081455_10546170 3300005937 Bacteria 767
31 Ga0070716_100581912 3300006173 Unclassified 839
32 Ga0070712_100400942 3300006175 Bacteria 1133
33 Ga0070712_100444853 3300006175 Bacteria 1078
34 Ga0070712_101259999 3300006175 Bacteria 644
35 Ga0068871_100539277 3300006358 Unclassified 1055
36 Ga0075428_100616916 3300006844 Unclassified 1158
37 Ga0075428_101293801 3300006844 Bacteria 767
38 Ga0075430_100426477 3300006846 Unclassified 1095
39 Ga0075430_101293308 3300006846 Unclassified 600
40 Ga0075431_100009180 3300006847 Bacteria 9919
41 Ga0075431_100713648 3300006847 Unclassified 980
42 Ga0075433_10343155 3300006852 Bacteria 1320
43 Ga0075433_10714653 3300006852 Bacteria 877
44 Ga0075433_11695054 3300006852 Bacteria 544
45 Ga0075434_100707007 3300006871 Unclassified 1025
46 Ga0075434_101546661 3300006871 Unclassified 672
47 Ga0075434_101743872 3300006871 Bacteria 630
48 Ga0075429_100251332 3300006880 Bacteria 1548
49 Ga0075429_100652361 3300006880 Bacteria 922
50 Ga0075429_100677227 3300006880 Unclassified 904
51 Ga0075436_100153900 3300006914 Bacteria 1619
52 Ga0097620_100486569 3300006931 Unclassified 1329
53 Ga0097620_102499766 3300006931 Bacteria 569
54 Ga0099794_10304751 3300007265 Bacteria 825
55 Ga0111539_10196306 3300009094 Bacteria 2354
56 Ga0111539_10406372 3300009094 Bacteria 1586
57 Ga0114129_10469403 3300009147 Bacteria 1648
58 Ga0114129_10981031 3300009147 Bacteria 1065
59 Ga0105242_10239228 3300009176 Bacteria 1631
60 Ga0157378_10315484 3300013297 Bacteria 1517
61 Ga0157378_11455028 3300013297 Bacteria 729
62 Ga0157378_12029589 3300013297 Unclassified 625
63 Ga0157378_13030202 3300013297 Unclassified 521
64 Ga0163163_10030687 3300014325 Bacteria 5181
65 Ga0163163_10675870 3300014325 Bacteria 1096
66 Ga0157380_10419458 3300014326 Bacteria 1276
67 Ga0157380_11034972 3300014326 Bacteria 856
68 Ga0157380_13032813 3300014326 Unclassified 535
69 Ga0157377_11499777 3300014745 Unclassified 536
70 Ga0157379_10147431 3300014968 Bacteria 2122
71 Ga0157379_10644544 3300014968 Bacteria 991
72 Ga0207684_11234910 3300025910 Bacteria 618
73 Ga0207693_10417094 3300025915 Bacteria 1049
74 Ga0207693_11095562 3300025915 Bacteria 605
75 Ga0207694_10930205 3300025924 Unclassified 735
76 Ga0207700_11047997 3300025928 Bacteria 730
77 Ga0207670_10003355 3300025936 Bacteria 8498
78 Ga0207670_10209395 3300025936 Bacteria 1486
79 Ga0207665_10157120 3300025939 Bacteria 1633
80 Ga0207665_10731085 3300025939 Bacteria 779
81 Ga0207711_11548983 3300025941 Unclassified 606
82 Ga0207651_11188281 3300025960 Unclassified 685
83 Ga0207677_12080193 3300026023 Unclassified 528
84 Ga0207641_10105166 3300026088 Unclassified 2493
85 Ga0207641_10251844 3300026088 Bacteria 1650
86 Ga0207676_10111699 3300026095 Unclassified 2288
87 Ga0207428_10504932 3300027907 Bacteria 878
88 Ga0265337_1066401 3300028556 Bacteria 994
89 Ga0265326_10037956 3300028558 Bacteria 1369
90 Ga0265326_10176857 3300028558 Bacteria 611
91 Ga0265322_10200580 3300028654 Bacteria 571
92 Ga0265336_10197715 3300028666 Bacteria 597
93 Ga0265338_10000008 3300028800 Bacteria 481542
94 Ga0265338_10000232 3300028800 Bacteria 103731
95 Ga0265338_10000552 3300028800 Bacteria 65513
96 Ga0265338_10002479 3300028800 Bacteria 27575
97 Ga0265338_10083214 3300028800 Bacteria 2677
98 Ga0265338_10188042 3300028800 Bacteria 1568
99 Ga0265324_10001087 3300029957 Bacteria 16364
100 Ga0265324_10014158 3300029957 Bacteria 2958
101 Ga0265324_10086128 3300029957 Bacteria 1068
102 Ga0265324_10141414 3300029957 Bacteria 817
103 Ga0265324_10159066 3300029957 Bacteria 767
104 Ga0265766_1026059 3300030863 Unclassified 503
105 Ga0265760_10144132 3300031090 Unclassified 777
106 Ga0265320_10002885 3300031240 Bacteria 11789
107 Ga0265320_10006159 3300031240 Bacteria 7595
108 Ga0265320_10034772 3300031240 Bacteria 2560
109 Ga0265320_10323374 3300031240 Unclassified 682
110 Ga0265320_10506763 3300031240 Unclassified 533
111 Ga0265325_10159310 3300031241 Bacteria 1063
112 Ga0265339_10036319 3300031249 Bacteria 2759
113 Ga0265339_10081805 3300031249 Bacteria 1706
114 Ga0265327_10066712 3300031251 Bacteria 1815
115 Ga0265316_10429048 3300031344 Bacteria 950
116 Ga0265342_10622595 3300031712 Bacteria 543
117 Ga0316596_1193485 3300033541 Unclassified 565
118 Ga0373944_0024302 3300035089 Bacteria 1775
119 Ga0373951_0171730 3300035091 Bacteria 618
120 Ga0373932_0279457 3300035112 Unclassified 617
121 Ga0373939_0105461 3300035114 Unclassified 974
122 Ga0373942_0134362 3300035207 Unclassified 783
123 Ga0373961_0356822 3300035241 Unclassified 552
124 Ga0373931_0603392 3300035691 Unclassified 718
125 Ga0373935_0875452 3300035692 Unclassified 665
126 Ga0373947_0696495 3300035725 Unclassified 693
127 Ga0373937_0711746 3300036401 Bacteria 951
128 Ga0373925_0857976 3300037068 Bacteria 748
129 Ga0451787_484909 3300041441 Unclassified 821
130 Ga0451839_0622879 3300041496 Unclassified 519
131 Ga0451577_0036956 3300042876 Unclassified 4397
132 Ga0451577_0490478 3300042876 Unclassified 1115
133 Ga0451577_0632016 3300042876 Bacteria 971
134 Ga0453684_0239710 3300044712 Unclassified 2088
135 Ga0453684_0247635 3300044712 Unclassified 2048
136 Ga0453684_0612004 3300044712 Bacteria 1193
137 Ga0451576_0106527 3300045051 Bacteria 2917
138 Ga0451576_0245135 3300045051 Bacteria 1872
139 Ga0451576_0690676 3300045051 Bacteria 1072
140 Ga0451576_1131713 3300045051 Unclassified 819
141 Ga0495592_0000081 3300046454 Bacteria 83319
142 Ga0495641_0037400 3300046461 Unclassified 2275
143 Ga0495653_0750466 3300046463 Bacteria 590
144 Ga0495582_0129212 3300046473 Bacteria 1427
145 Ga0495639_0077781 3300046475 Bacteria 1541
146 Ga0495662_0039878 3300046476 Bacteria 2268
147 Ga0495628_0001847 3300046516 Bacteria 19222
148 Ga0495630_0099730 3300046517 Bacteria 2197
149 Ga0495630_0467248 3300046517 Unclassified 967
150 Ga0495630_0479887 3300046517 Bacteria 953
151 Ga0495666_0025344 3300046526 Bacteria 2928
152 Ga0495652_0093048 3300046529 Bacteria 2462
153 Ga0495640_0741998 3300046533 Bacteria 587
154 Ga0495586_0001100 3300046535 Bacteria 15256
155 Ga0495586_0091075 3300046535 Bacteria 1685
156 Ga0495586_0136464 3300046535 Bacteria 1375
157 Ga0495645_0013268 3300046543 Bacteria 5823
158 Ga0495634_0203947 3300046642 Bacteria 1227
159 Ga0495599_0009591 3300046678 Bacteria 5922
160 Ga0495599_0248485 3300046678 Bacteria 1083
161 Ga0495599_0652212 3300046678 Bacteria 610
162 Ga0495647_0027141 3300046681 Unclassified 2103
163 Ga0495658_0033135 3300046683 Bacteria 2827
164 Ga0495613_0105680 3300046689 Unclassified 2032
165 Ga0495624_0067534 3300046690 Bacteria 2230
166 Ga0495624_0180187 3300046690 Bacteria 1288
167 Ga0495676_0846462 3300047321 Bacteria 587
168 Ga0495684_0193183 3300047471 Bacteria 1504
169 Ga0501298_169719 3300049521 Unclassified 542
170 Ga0501260_045002 3300049689 Bacteria 544
171 nmdc:mga05p37_2014705_c1 3300050507 Unclassified 545
172 nmdc:mga05p37_382688_c1 3300050507 Bacteria 1648
173 nmdc:mga09592_1022331_c1 3300050508 Unclassified 690
174 nmdc:mga09592_393367_c1 3300050508 Unclassified 1198
175 nmdc:mga09592_464162_c1 3300050508 Bacteria 1092
176 nmdc:mga09592_607704_c1 3300050508 Bacteria 936
177 nmdc:mga0qj67_309890_c1 3300050509 Unclassified 1278
178 nmdc:mga06r32_304905_c1 3300050510 Bacteria 1578
179 nmdc:mga06r32_4576_c1 3300050510 Bacteria 12401
180 nmdc:mga08y16_452646_c1 3300050511 Bacteria 1309
181 nmdc:mga08y16_80842_c1 3300050511 Bacteria 3388
182 Ga0495601_0876123 3300053077 Unclassified 568
183 Ga0500651_0068112 3300053093 Bacteria 2217
184 Ga0451576_0071680
185 Ga0006770J48903_1046809
186 Ga0070683_101691275
187 Ga0070690_100002523
188 Ga0070690_100409067
189 Ga0070690_100834274
190 Ga0068868_101342923
191 Ga0070689_100009574
192 Ga0070689_101924835
193 Ga0070674_101752306
194 Ga0070688_100037434
195 Ga0070688_100404332
196 Ga0070713_100096526
197 Ga0070711_100567494
198 Ga0070705_100309853
199 Ga0070705_100423442
200 Ga0070705_101028162
201 Ga0070708_102045644
202 Ga0070707_102131553
203 Ga0070686_100287404
204 Ga0070704_100163632
205 Ga0070704_100711342
206 Ga0068855_100879064
207 Ga0068859_100486619
208 Ga0068859_102499941
209 Ga0068864_100039396
210 Ga0068866_11227909
211 Ga0068863_100092812
212 Ga0068860_102425938
213 Ga0081455_10546170
214 Ga0070716_100581912
215 Ga0070712_100400942
216 Ga0070712_100444853
217 Ga0070712_101259999
218 Ga0068871_100539277
219 Ga0075428_100616916
220 Ga0075428_101293801
221 Ga0075430_100426477
222 Ga0075430_101293308
223 Ga0075431_100009180
224 Ga0075431_100713648
225 Ga0075433_10343155
226 Ga0075433_10714653
227 Ga0075433_11695054
228 Ga0075434_100707007
229 Ga0075434_101546661
230 Ga0075434_101743872
231 Ga0075429_100251332
232 Ga0075429_100652361
233 Ga0075429_100677227
234 Ga0075436_100153900
235 Ga0097620_100486569
236 Ga0097620_102499766
237 Ga0099794_10304751
238 Ga0111539_10196306
239 Ga0111539_10406372
240 Ga0114129_10469403
241 Ga0114129_10981031
242 Ga0105242_10239228
243 Ga0157378_10315484
244 Ga0157378_11455028
245 Ga0157378_12029589
246 Ga0157378_13030202
247 Ga0163163_10030687
248 Ga0163163_10675870
249 Ga0157380_10419458
250 Ga0157380_11034972
251 Ga0157380_13032813
252 Ga0157377_11499777
253 Ga0157379_10147431
254 Ga0157379_10644544
255 Ga0207684_11234910
256 Ga0207693_10417094
257 Ga0207693_11095562
258 Ga0207694_10930205
259 Ga0207700_11047997
260 Ga0207670_10003355
261 Ga0207670_10209395
262 Ga0207665_10157120
263 Ga0207665_10731085
264 Ga0207711_11548983
265 Ga0207651_11188281
266 Ga0207677_12080193
267 Ga0207641_10105166
268 Ga0207641_10251844
269 Ga0207676_10111699
270 Ga0207428_10504932
271 Ga0265337_1066401
272 Ga0265326_10037956
273 Ga0265326_10176857
274 Ga0265322_10200580
275 Ga0265336_10197715
276 Ga0265338_10000008
277 Ga0265338_10000232
278 Ga0265338_10000552
279 Ga0265338_10002479
280 Ga0265338_10083214
281 Ga0265338_10188042
282 Ga0265324_10001087
283 Ga0265324_10014158
284 Ga0265324_10086128
285 Ga0265324_10141414
286 Ga0265324_10159066
287 Ga0265766_1026059
288 Ga0265760_10144132
289 Ga0265320_10002885
290 Ga0265320_10006159
291 Ga0265320_10034772
292 Ga0265320_10323374
293 Ga0265320_10506763
294 Ga0265325_10159310
295 Ga0265339_10036319
296 Ga0265339_10081805
297 Ga0265327_10066712
298 Ga0265316_10429048
299 Ga0265342_10622595
300 Ga0316596_1193485
301 Ga0373944_0024302
302 Ga0373951_0171730
303 Ga0373932_0279457
304 Ga0373939_0105461
305 Ga0373942_0134362
306 Ga0373961_0356822
307 Ga0373931_0603392
308 Ga0373935_0875452
309 Ga0373947_0696495
310 Ga0373937_0711746
311 Ga0373925_0857976
312 Ga0451787_484909
313 Ga0451839_0622879
314 Ga0451577_0036956
315 Ga0451577_0490478
316 Ga0451577_0632016
317 Ga0453684_0239710
318 Ga0453684_0247635
319 Ga0453684_0612004
320 Ga0451576_0106527
321 Ga0451576_0245135
322 Ga0451576_0690676
323 Ga0451576_1131713
324 Ga0495592_0000081
325 Ga0495641_0037400
326 Ga0495653_0750466
327 Ga0495582_0129212
328 Ga0495639_0077781
329 Ga0495662_0039878
330 Ga0495628_0001847
331 Ga0495630_0099730
332 Ga0495630_0467248
333 Ga0495630_0479887
334 Ga0495666_0025344
335 Ga0495652_0093048
336 Ga0495640_0741998
337 Ga0495586_0001100
338 Ga0495586_0091075
339 Ga0495586_0136464
340 Ga0495645_0013268
341 Ga0495634_0203947
342 Ga0495599_0009591
343 Ga0495599_0248485
344 Ga0495599_0652212
345 Ga0495647_0027141
346 Ga0495658_0033135
347 Ga0495613_0105680
348 Ga0495624_0067534
349 Ga0495624_0180187
350 Ga0495676_0846462
351 Ga0495684_0193183
352 Ga0501298_169719
353 Ga0501260_045002
354 nmdc:mga05p37_2014705_c1
355 nmdc:mga05p37_382688_c1
356 nmdc:mga09592_1022331_c1
357 nmdc:mga09592_393367_c1
358 nmdc:mga09592_464162_c1
359 nmdc:mga09592_607704_c1
360 nmdc:mga0qj67_309890_c1
361 nmdc:mga06r32_304905_c1
362 nmdc:mga06r32_4576_c1
363 nmdc:mga08y16_452646_c1
364 nmdc:mga08y16_80842_c1
365 Ga0495601_0876123
366 Ga0500651_0068112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

2

74

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v6r-assembly1.cif.gz_AF error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7602 3 76
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7575 3 76
7bge-assembly1.cif.gz_c staphylococcus aureus 30s ribosomal subunit in presence of spermidine (head only) 0.7514 3 80
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.748 3 80
7ooc-assembly1.cif.gz_B mycoplasma pneumoniae 30s subunit of ribosomes in chloramphenicol-treated cells 0.741 4 78
ID Description Score Start End Superfamily
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9339 6 76 3.30.300.20
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9084 6 76 3.30.300.20
af_Q58447_73_141_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8076 2 75 3.30.300.20
af_Q2FW12_17_106_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7843 2 78 3.30.300.20
af_Q58447_73_141_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.766 2 75 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A6L4AYE8-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9969 2 77 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A7Y3L329-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9955 1 75 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A4Q2YG58-F1-model_v4 KH domain-containing protein 0.9908 2 76
AF-A0A2V2CJA8-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9899 1 76 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A7X8J8M2-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9892 2 76 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555

Map