F281174

General Info

Members Datasets Scaffolds Average Seq Length
183 89 366 196

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0006622|Ga0395900_0006622_546_1211
Length 221
Sequence VPDEFRASTTSEPGTIHDRKETEMRKVIVNEFMSLDGVAQAPGGAEEDPSGGFRHGGWHMQYMEDEPSQKWVLGSIDEAGAFLLGRRTYEIFASYWPNAPAEEQVVAEPLNTKPKYVASTTLAQPLEWQNSTLLEGDVAEAVAALKQEEGGDVHVIGSTKLVQSLIEHDLVDELRVMIDPVVVGGGKRFFPDDGALRPLRLVDGQVASTGAILATFARTAG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
5 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
27 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
28 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
37 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
46 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
47 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
64 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
74 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
77 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
85 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
86 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
87 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
88 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0006622 3300037418 Bacteria 12054
2 Ga0070683_100003478 3300005329 Bacteria 12804
3 Ga0070713_100010952 3300005436 Bacteria 6577
4 Ga0070684_100000407 3300005535 Bacteria 29480
5 Ga0070684_100030509 3300005535 Bacteria 4581
6 Ga0070664_100221522 3300005564 Bacteria 1693
7 Ga0068857_100001170 3300005577 Bacteria 20459
8 Ga0068857_100188766 3300005577 Bacteria 1877
9 Ga0081455_10359871 3300005937 Bacteria 1023
10 Ga0081540_1004968 3300005983 Bacteria 10001
11 Ga0081540_1012114 3300005983 Bacteria 5704
12 Ga0081540_1047649 3300005983 Unclassified 2153
13 Ga0081539_10004336 3300005985 Bacteria 15819
14 Ga0070717_10004232 3300006028 Bacteria 10346
15 Ga0075428_100023683 3300006844 Bacteria 6796
16 Ga0075428_101413851 3300006844 Bacteria 730
17 Ga0075430_100014789 3300006846 Bacteria 6645
18 Ga0075430_100085767 3300006846 Bacteria 2636
19 Ga0075431_100025318 3300006847 Bacteria 6083
20 Ga0075431_100038410 3300006847 Bacteria 4930
21 Ga0075433_10025807 3300006852 Bacteria 4969
22 Ga0075434_100039983 3300006871 Bacteria 4645
23 Ga0075429_100231641 3300006880 Bacteria 1618
24 Ga0075429_100630711 3300006880 Bacteria 939
25 Ga0075436_100021681 3300006914 Bacteria 4408
26 Ga0075435_100016183 3300007076 Bacteria 5620
27 Ga0111539_10038426 3300009094 Bacteria 5773
28 Ga0111539_10117169 3300009094 Bacteria 3123
29 Ga0111539_10705667 3300009094 Bacteria 1174
30 Ga0111539_10887000 3300009094 Bacteria 1037
31 Ga0111539_11018755 3300009094 Bacteria 962
32 Ga0114129_10191387 3300009147 Bacteria 2777
33 Ga0114129_10322323 3300009147 Bacteria 2054
34 Ga0114129_10512865 3300009147 Bacteria 1564
35 Ga0207700_10276413 3300025928 Bacteria 1443
36 Ga0207664_10019652 3300025929 Bacteria 4997
37 Ga0207661_10036817 3300025944 Bacteria 3822
38 Ga0207679_10156137 3300025945 Bacteria 1863
39 Ga0207674_10001150 3300026116 Bacteria 34275
40 Ga0207674_10183190 3300026116 Bacteria 2045
41 Ga0207428_10001520 3300027907 Bacteria 24213
42 Ga0307405_10009991 3300031731 Bacteria 4894
43 Ga0307405_10056108 3300031731 Bacteria 2469
44 Ga0307405_10964472 3300031731 Bacteria 725
45 Ga0307413_10151202 3300031824 Bacteria 1618
46 Ga0307410_10059466 3300031852 Bacteria 2609
47 Ga0307406_10413766 3300031901 Bacteria 1072
48 Ga0307407_10144348 3300031903 Bacteria 1539
49 Ga0307407_10490020 3300031903 Bacteria 899
50 Ga0307412_10050549 3300031911 Bacteria 2744
51 Ga0307412_10339358 3300031911 Bacteria 1202
52 Ga0307409_100631604 3300031995 Bacteria 1062
53 Ga0307409_100686976 3300031995 Bacteria 1021
54 Ga0307416_100002763 3300032002 Bacteria 10186
55 Ga0307416_100014355 3300032002 Bacteria 5425
56 Ga0307416_100024687 3300032002 Bacteria 4393
57 Ga0307416_100037035 3300032002 Bacteria 3749
58 Ga0307416_100424989 3300032002 Bacteria 1374
59 Ga0307415_100001389 3300032126 Bacteria 11555
60 Ga0307415_100006097 3300032126 Bacteria 6465
61 Ga0307415_100006589 3300032126 Bacteria 6277
62 Ga0307415_100245077 3300032126 Bacteria 1452
63 Ga0373945_0478556 3300035116 Bacteria 553
64 Ga0373925_0437673 3300037068 Bacteria 1070
65 Ga0395899_0005799 3300037312 Bacteria 9583
66 Ga0395899_0015144 3300037312 Bacteria 5879
67 Ga0395899_0028278 3300037312 Bacteria 4222
68 Ga0395899_0039764 3300037312 Bacteria 3519
69 Ga0395899_0102827 3300037312 Bacteria 2061
70 Ga0395899_0192858 3300037312 Bacteria 1425
71 Ga0395899_0421681 3300037312 Bacteria 879
72 Ga0395900_0002349 3300037418 Bacteria 20946
73 Ga0395900_0004079 3300037418 Bacteria 15573
74 Ga0395900_0009163 3300037418 Bacteria 10142
75 Ga0395900_0028444 3300037418 Bacteria 5725
76 Ga0395900_0071114 3300037418 Bacteria 3576
77 Ga0395900_0081217 3300037418 Unclassified 3330
78 Ga0395900_0094190 3300037418 Bacteria 3076
79 Ga0395900_0094230 3300037418 Bacteria 3076
80 Ga0395900_0138482 3300037418 Bacteria 2493
81 Ga0395900_0299292 3300037418 Bacteria 1595
82 Ga0395900_0509360 3300037418 Bacteria 1153
83 Ga0395898_0000723 3300037466 Bacteria 58117
84 Ga0395898_0011129 3300037466 Bacteria 9367
85 Ga0395898_0017038 3300037466 Bacteria 7421
86 Ga0395898_0040569 3300037466 Bacteria 4603
87 Ga0395898_0079029 3300037466 Bacteria 3173
88 Ga0395898_0123759 3300037466 Bacteria 2478
89 Ga0395898_0149343 3300037466 Bacteria 2236
90 Ga0395898_0169381 3300037466 Bacteria 2088
91 Ga0395898_0170729 3300037466 Bacteria 2079
92 Ga0395898_0249651 3300037466 Bacteria 1692
93 Ga0395898_0311667 3300037466 Bacteria 1501
94 Ga0395898_0326614 3300037466 Bacteria 1463
95 Ga0395905_0002667 3300037471 Bacteria 19578
96 Ga0395905_0016430 3300037471 Bacteria 7034
97 Ga0395905_0021441 3300037471 Bacteria 6109
98 Ga0395905_0033737 3300037471 Bacteria 4807
99 Ga0395905_0039441 3300037471 Bacteria 4431
100 Ga0395905_0059739 3300037471 Bacteria 3564
101 Ga0395905_0251207 3300037471 Bacteria 1652
102 Ga0395905_0392359 3300037471 Bacteria 1282
103 Ga0395905_0810366 3300037471 Bacteria 839
104 Ga0395901_0005173 3300038443 Bacteria 13163
105 Ga0395901_0013905 3300038443 Bacteria 8190
106 Ga0395901_0018541 3300038443 Bacteria 7105
107 Ga0395901_0021062 3300038443 Bacteria 6679
108 Ga0395901_0027312 3300038443 Bacteria 5863
109 Ga0395901_0035578 3300038443 Bacteria 5146
110 Ga0395901_0182557 3300038443 Bacteria 2201
111 Ga0395901_0366208 3300038443 Bacteria 1485
112 Ga0395901_0390526 3300038443 Bacteria 1431
113 Ga0395901_0434524 3300038443 Bacteria 1344
114 Ga0395901_0466207 3300038443 Bacteria 1290
115 Ga0395901_0535317 3300038443 Bacteria 1189
116 Ga0395901_0909323 3300038443 Bacteria 861
117 Ga0439439_0010712 3300041406 Bacteria 2196
118 Ga0439461_0074101 3300041410 Bacteria 793
119 Ga0439433_0005622 3300041999 Bacteria 2692
120 Ga0439462_0040205 3300042015 Bacteria 1247
121 Ga0450923_105742 3300042125 Bacteria 653
122 Ga0439440_0191454 3300042993 Bacteria 603
123 Ga0466972_0014483 3300044658 Bacteria 3950
124 Ga0466965_0193063 3300044683 Bacteria 1078
125 Ga0466963_0001916 3300044694 Bacteria 11392
126 Ga0466963_0005941 3300044694 Bacteria 7188
127 Ga0466963_0006739 3300044694 Bacteria 6825
128 Ga0466964_0003441 3300044706 Bacteria 5773
129 Ga0466964_0136717 3300044706 Bacteria 1122
130 Ga0466971_0003722 3300044719 Bacteria 6526
131 Ga0466957_0003297 3300044842 Bacteria 8839
132 Ga0466957_0013470 3300044842 Bacteria 4742
133 Ga0466960_0031286 3300044901 Unclassified 2455
134 Ga0466959_0118534 3300045049 Bacteria 1884
135 Ga0466958_0001895 3300045836 Bacteria 10231
136 Ga0466967_0015045 3300045976 Bacteria 6053
137 Ga0466967_0021002 3300045976 Bacteria 5290
138 Ga0466967_0094994 3300045976 Bacteria 2716
139 Ga0466967_2554410 3300045976 Bacteria 505
140 Ga0495641_0034459 3300046461 Bacteria 2393
141 Ga0495651_0136737 3300046462 Bacteria 1782
142 Ga0495664_0116017 3300046477 Bacteria 1618
143 Ga0495664_0542634 3300046477 Bacteria 693
144 Ga0495664_0643469 3300046477 Bacteria 629
145 Ga0495594_0060845 3300046499 Bacteria 2089
146 Ga0495630_0101734 3300046517 Bacteria 2174
147 Ga0495630_0650573 3300046517 Unclassified 807
148 Ga0495624_0257395 3300046690 Bacteria 1055
149 Ga0495676_0001350 3300047321 Bacteria 21088
150 Ga0495680_0455441 3300047322 Bacteria 875
151 Ga0496108_0224712 3300048911 Bacteria 1632
152 Ga0496109_0357930 3300048912 Bacteria 1379
153 Ga0496109_0449408 3300048912 Bacteria 1217
154 Ga0496110_0511160 3300048913 Unclassified 1093
155 Ga0496111_0156060 3300048914 Bacteria 1694
156 Ga0496115_0295105 3300048918 Bacteria 1329
157 Ga0501040_0307834 3300049576 Bacteria 1133
158 Ga0501041_0294118 3300049577 Bacteria 1023
159 Ga0501067_0092057 3300049583 Bacteria 1683
160 Ga0501068_0327771 3300049584 Bacteria 982
161 Ga0501076_0645923 3300049592 Bacteria 873
162 Ga0501209_170596 3300049656 Bacteria 661
163 Ga0501079_0410926 3300049741 Bacteria 1062
164 nmdc:mga05p37_1195048_c1 3300050507 Bacteria 786
165 nmdc:mga05p37_152343_c1 3300050507 Bacteria 2827
166 nmdc:mga05p37_195988_c1 3300050507 Bacteria 2449
167 nmdc:mga09592_115688_c1 3300050508 Bacteria 2302
168 nmdc:mga09592_328289_c1 3300050508 Bacteria 1325
169 nmdc:mga0qj67_114151_c1 3300050509 Bacteria 2182
170 nmdc:mga0qj67_22574_c1 3300050509 Bacteria 4834
171 nmdc:mga0qj67_22779_c1 3300050509 Bacteria 4812
172 nmdc:mga06r32_163843_c1 3300050510 Bacteria 2206
173 nmdc:mga06r32_38735_c1 3300050510 Bacteria 4519
174 nmdc:mga06r32_395257_c1 3300050510 Bacteria 1365
175 nmdc:mga06r32_58923_c1 3300050510 Bacteria 3691
176 nmdc:mga08y16_17380_c1 3300050511 Bacteria 7574
177 nmdc:mga0n895_9688_c1 3300050512 Bacteria 8450
178 nmdc:mga0rr50_3450_c1 3300050513 Bacteria 9098
179 nmdc:mga0a205_4964_c1 3300050515 Bacteria 11968
180 Ga0495601_0534037 3300053077 Bacteria 755
181 Ga0495612_0070341 3300053078 Bacteria 1458
182 Ga0590077_051716 3300059426 Bacteria 923
183 Ga0466962_0017152 3300061719 Bacteria 3489
184 Ga0395900_0006622
185 Ga0070683_100003478
186 Ga0070713_100010952
187 Ga0070684_100000407
188 Ga0070684_100030509
189 Ga0070664_100221522
190 Ga0068857_100001170
191 Ga0068857_100188766
192 Ga0081455_10359871
193 Ga0081540_1004968
194 Ga0081540_1012114
195 Ga0081540_1047649
196 Ga0081539_10004336
197 Ga0070717_10004232
198 Ga0075428_100023683
199 Ga0075428_101413851
200 Ga0075430_100014789
201 Ga0075430_100085767
202 Ga0075431_100025318
203 Ga0075431_100038410
204 Ga0075433_10025807
205 Ga0075434_100039983
206 Ga0075429_100231641
207 Ga0075429_100630711
208 Ga0075436_100021681
209 Ga0075435_100016183
210 Ga0111539_10038426
211 Ga0111539_10117169
212 Ga0111539_10705667
213 Ga0111539_10887000
214 Ga0111539_11018755
215 Ga0114129_10191387
216 Ga0114129_10322323
217 Ga0114129_10512865
218 Ga0207700_10276413
219 Ga0207664_10019652
220 Ga0207661_10036817
221 Ga0207679_10156137
222 Ga0207674_10001150
223 Ga0207674_10183190
224 Ga0207428_10001520
225 Ga0307405_10009991
226 Ga0307405_10056108
227 Ga0307405_10964472
228 Ga0307413_10151202
229 Ga0307410_10059466
230 Ga0307406_10413766
231 Ga0307407_10144348
232 Ga0307407_10490020
233 Ga0307412_10050549
234 Ga0307412_10339358
235 Ga0307409_100631604
236 Ga0307409_100686976
237 Ga0307416_100002763
238 Ga0307416_100014355
239 Ga0307416_100024687
240 Ga0307416_100037035
241 Ga0307416_100424989
242 Ga0307415_100001389
243 Ga0307415_100006097
244 Ga0307415_100006589
245 Ga0307415_100245077
246 Ga0373945_0478556
247 Ga0373925_0437673
248 Ga0395899_0005799
249 Ga0395899_0015144
250 Ga0395899_0028278
251 Ga0395899_0039764
252 Ga0395899_0102827
253 Ga0395899_0192858
254 Ga0395899_0421681
255 Ga0395900_0002349
256 Ga0395900_0004079
257 Ga0395900_0009163
258 Ga0395900_0028444
259 Ga0395900_0071114
260 Ga0395900_0081217
261 Ga0395900_0094190
262 Ga0395900_0094230
263 Ga0395900_0138482
264 Ga0395900_0299292
265 Ga0395900_0509360
266 Ga0395898_0000723
267 Ga0395898_0011129
268 Ga0395898_0017038
269 Ga0395898_0040569
270 Ga0395898_0079029
271 Ga0395898_0123759
272 Ga0395898_0149343
273 Ga0395898_0169381
274 Ga0395898_0170729
275 Ga0395898_0249651
276 Ga0395898_0311667
277 Ga0395898_0326614
278 Ga0395905_0002667
279 Ga0395905_0016430
280 Ga0395905_0021441
281 Ga0395905_0033737
282 Ga0395905_0039441
283 Ga0395905_0059739
284 Ga0395905_0251207
285 Ga0395905_0392359
286 Ga0395905_0810366
287 Ga0395901_0005173
288 Ga0395901_0013905
289 Ga0395901_0018541
290 Ga0395901_0021062
291 Ga0395901_0027312
292 Ga0395901_0035578
293 Ga0395901_0182557
294 Ga0395901_0366208
295 Ga0395901_0390526
296 Ga0395901_0434524
297 Ga0395901_0466207
298 Ga0395901_0535317
299 Ga0395901_0909323
300 Ga0439439_0010712
301 Ga0439461_0074101
302 Ga0439433_0005622
303 Ga0439462_0040205
304 Ga0450923_105742
305 Ga0439440_0191454
306 Ga0466972_0014483
307 Ga0466965_0193063
308 Ga0466963_0001916
309 Ga0466963_0005941
310 Ga0466963_0006739
311 Ga0466964_0003441
312 Ga0466964_0136717
313 Ga0466971_0003722
314 Ga0466957_0003297
315 Ga0466957_0013470
316 Ga0466960_0031286
317 Ga0466959_0118534
318 Ga0466958_0001895
319 Ga0466967_0015045
320 Ga0466967_0021002
321 Ga0466967_0094994
322 Ga0466967_2554410
323 Ga0495641_0034459
324 Ga0495651_0136737
325 Ga0495664_0116017
326 Ga0495664_0542634
327 Ga0495664_0643469
328 Ga0495594_0060845
329 Ga0495630_0101734
330 Ga0495630_0650573
331 Ga0495624_0257395
332 Ga0495676_0001350
333 Ga0495680_0455441
334 Ga0496108_0224712
335 Ga0496109_0357930
336 Ga0496109_0449408
337 Ga0496110_0511160
338 Ga0496111_0156060
339 Ga0496115_0295105
340 Ga0501040_0307834
341 Ga0501041_0294118
342 Ga0501067_0092057
343 Ga0501068_0327771
344 Ga0501076_0645923
345 Ga0501209_170596
346 Ga0501079_0410926
347 nmdc:mga05p37_1195048_c1
348 nmdc:mga05p37_152343_c1
349 nmdc:mga05p37_195988_c1
350 nmdc:mga09592_115688_c1
351 nmdc:mga09592_328289_c1
352 nmdc:mga0qj67_114151_c1
353 nmdc:mga0qj67_22574_c1
354 nmdc:mga0qj67_22779_c1
355 nmdc:mga06r32_163843_c1
356 nmdc:mga06r32_38735_c1
357 nmdc:mga06r32_395257_c1
358 nmdc:mga06r32_58923_c1
359 nmdc:mga08y16_17380_c1
360 nmdc:mga0n895_9688_c1
361 nmdc:mga0rr50_3450_c1
362 nmdc:mga0a205_4964_c1
363 Ga0495601_0534037
364 Ga0495612_0070341
365 Ga0590077_051716
366 Ga0466962_0017152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

25

213

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8388 1 196
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8344 1 196
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8256 1 196
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8214 1 196
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8168 2 196
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8333 1 196 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8288 1 196 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8131 2 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8083 2 193 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7821 4 194 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A328VF86-F1-model_v4 Pyrimidine reductase 0.9482 1 196 GO:0008703
GO:0009231
AF-K9RR86-F1-model_v4 Dihydrofolate reductase 0.9404 1 195 GO:0008703
GO:0009231
AF-A0A328VF86-F1-model_v4 Pyrimidine reductase 0.933 1 196 GO:0008703
GO:0009231
AF-A0A1C4VD23-F1-model_v4 RibD C-terminal domain-containing protein 0.9327 48 195 GO:0008703
GO:0009231
AF-A0A6N4EF26-F1-model_v4 deleted 0.9323 2 196

Map