F280777

General Info

Members Datasets Scaffolds Average Seq Length
183 121 366 393

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10108368|Ga0114129_101083683
Length 430
Sequence MDVIRQKVRVDFEYPVYFTTGVLTPSNLLLRDVIARSADESPSRVLVVLDRGVHDRHPALVSQAEEYCRRHRTVLNLAGPVLDVPGGEAVKNDSRHVDAIHAAINRAGLCRHSYVVAIGGGAVLDAVGYAAATAHRGIRLIRVPTTVLSQDDSAMGVKNGINAFGKKNYLGTFAPPFAVINDAEFLRTLPDREWRAGISEAIKAALIKDRAFFDLIEQQAPALKARDLGAMEQVIRRCAALHLTHIATSGDPFELGSSRPLDFGHWSAHKLEQLTAHRLGHGEAVAIGIALDSTYSYLSGFLPEDDWRRILSLMPSLGLAVYVPELSQHLEEPAFAEATADQPDPDYPASVLRGLDEFREHLGGTLTILMLRSIGAPFDVHEIRRDVMIRSIGVLRDFEQAHRARHAAGGEDHHGRHPSAGSPAEPERTG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
119 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
120 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
121 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 2.19
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10108368 3300009147 Bacteria 3835
2 JGI25151J46595_10015572 3300003187 Bacteria 3346
3 JGI25406J46586_10018381 3300003203 Bacteria 2873
4 Ga0070670_100107039 3300005331 Bacteria 2410
5 Ga0068868_100046839 3300005338 Unclassified 3385
6 Ga0068868_100298748 3300005338 Bacteria 1367
7 Ga0070675_100066398 3300005354 Bacteria 2984
8 Ga0070674_100029532 3300005356 Bacteria 3613
9 Ga0070674_100064844 3300005356 Unclassified 2561
10 Ga0070685_10026703 3300005466 Bacteria 3184
11 Ga0070699_100049084 3300005518 Bacteria 3653
12 Ga0068853_100006669 3300005539 Bacteria 9193
13 Ga0070672_100276382 3300005543 Bacteria 1419
14 Ga0070696_100000426 3300005546 Bacteria 26443
15 Ga0070665_100000130 3300005548 Bacteria 141805
16 Ga0068855_100013178 3300005563 Bacteria 9973
17 Ga0068857_100061434 3300005577 Bacteria 3338
18 Ga0068856_100184192 3300005614 Bacteria 2101
19 Ga0068859_100030284 3300005617 Bacteria 5431
20 Ga0068863_100002230 3300005841 Bacteria 19238
21 Ga0081455_10025823 3300005937 Bacteria 5415
22 Ga0081538_10015783 3300005981 Bacteria 5827
23 Ga0081538_10024070 3300005981 Bacteria 4350
24 Ga0081538_10056355 3300005981 Bacteria 2303
25 Ga0081539_10003142 3300005985 Bacteria 21017
26 Ga0075368_10009531 3300006042 Bacteria 3491
27 Ga0075367_10016092 3300006178 Bacteria 4079
28 Ga0075428_100019426 3300006844 Bacteria 7521
29 Ga0075428_100029859 3300006844 Bacteria 6030
30 Ga0075428_100219705 3300006844 Bacteria 2052
31 Ga0075430_100002859 3300006846 Bacteria 14445
32 Ga0075430_100009622 3300006846 Bacteria 8169
33 Ga0075430_100026431 3300006846 Bacteria 4938
34 Ga0075431_100010536 3300006847 Bacteria 9294
35 Ga0075431_100014700 3300006847 Bacteria 7923
36 Ga0075431_100024436 3300006847 Bacteria 6193
37 Ga0075431_100046534 3300006847 Bacteria 4474
38 Ga0075433_10112215 3300006852 Bacteria 2418
39 Ga0075434_100103900 3300006871 Bacteria 2850
40 Ga0097620_100030284 3300006931 Bacteria 5431
41 Ga0105240_10026468 3300009093 Bacteria 7611
42 Ga0105240_10112635 3300009093 Bacteria 3288
43 Ga0111539_10015701 3300009094 Bacteria 9413
44 Ga0111539_10017847 3300009094 Bacteria 8788
45 Ga0111539_10029472 3300009094 Bacteria 6684
46 Ga0111539_10273044 3300009094 Bacteria 1968
47 Ga0114129_10050464 3300009147 Bacteria 5844
48 Ga0114129_10065711 3300009147 Bacteria 5062
49 Ga0114129_10082007 3300009147 Bacteria 4482
50 Ga0105241_10046432 3300009174 Unclassified 3298
51 Ga0105241_10174123 3300009174 Bacteria 1779
52 Ga0105239_10259659 3300010375 Bacteria 1952
53 Ga0157369_10000746 3300013105 Bacteria 41851
54 Ga0157374_10125685 3300013296 Unclassified 2479
55 Ga0163163_10116682 3300014325 Bacteria 2701
56 Ga0157380_10150642 3300014326 Bacteria 2010
57 Ga0157379_10238496 3300014968 Bacteria 1649
58 Ga0209025_1000113 3300025294 Bacteria 218943
59 Ga0207697_10000720 3300025315 Bacteria 18834
60 Ga0207688_10028189 3300025901 Bacteria 3090
61 Ga0207707_10269128 3300025912 Bacteria 1477
62 Ga0207695_10096017 3300025913 Bacteria 2966
63 Ga0207650_10002669 3300025925 Bacteria 12347
64 Ga0207650_10059173 3300025925 Bacteria 2855
65 Ga0207659_10080813 3300025926 Bacteria 2402
66 Ga0207706_10272745 3300025933 Bacteria 1476
67 Ga0207669_10052623 3300025937 Unclassified 2447
68 Ga0207689_10252235 3300025942 Bacteria 1459
69 Ga0207667_10012088 3300025949 Bacteria 9980
70 Ga0207658_10190768 3300025986 Bacteria 1703
71 Ga0207641_10000727 3300026088 Bacteria 35345
72 Ga0207674_10007741 3300026116 Bacteria 12505
73 Ga0207675_100016718 3300026118 Bacteria 6851
74 Ga0207683_10254006 3300026121 Bacteria 1604
75 Ga0209971_1020752 3300027682 Bacteria 1563
76 Ga0207428_10009154 3300027907 Bacteria 8896
77 Ga0207428_10027692 3300027907 Bacteria 4717
78 Ga0207428_10162122 3300027907 Bacteria 1697
79 Ga0268266_10000136 3300028379 Bacteria 141853
80 Ga0268264_10336836 3300028381 Bacteria 1432
81 Ga0265338_10004945 3300028800 Bacteria 17661
82 Ga0265338_10021708 3300028800 Bacteria 6680
83 Ga0265338_10061405 3300028800 Bacteria 3294
84 Ga0265338_10076697 3300028800 Bacteria 2829
85 Ga0265320_10030468 3300031240 Bacteria 2782
86 Ga0265325_10029673 3300031241 Bacteria 2937
87 Ga0265339_10009274 3300031249 Bacteria 6199
88 Ga0265316_10032400 3300031344 Bacteria 4264
89 Ga0307408_100003146 3300031548 Bacteria 11374
90 Ga0307408_100014831 3300031548 Bacteria 5182
91 Ga0307408_100099319 3300031548 Unclassified 2215
92 Ga0265313_10006631 3300031595 Bacteria 8123
93 Ga0307405_10089910 3300031731 Bacteria 2030
94 Ga0307413_10026476 3300031824 Bacteria 3197
95 Ga0307410_10033942 3300031852 Bacteria 3299
96 Ga0307410_10049832 3300031852 Bacteria 2813
97 Ga0307410_10209721 3300031852 Bacteria 1492
98 Ga0307406_10036058 3300031901 Unclassified 3045
99 Ga0307412_10106932 3300031911 Bacteria 1990
100 Ga0307409_100022845 3300031995 Bacteria 4319
101 Ga0307409_100190439 3300031995 Bacteria 1825
102 Ga0307416_100026395 3300032002 Bacteria 4279
103 Ga0307414_10000059 3300032004 Bacteria 112136
104 Ga0307415_100019229 3300032126 Bacteria 4143
105 Ga0307415_100263406 3300032126 Bacteria 1408
106 Ga0307507_10070643 3300033179 Bacteria 3165
107 Ga0373954_0019498 3300035118 Bacteria 3060
108 Ga0373933_0039062 3300035724 Bacteria 2791
109 Ga0373937_0062765 3300036401 Bacteria 3416
110 Ga0316582_0160517 3300036647 Bacteria 1523
111 Ga0373925_0263036 3300037068 Unclassified 1386
112 Ga0395901_0079725 3300038443 Bacteria 3419
113 Ga0439450_001912 3300042008 Bacteria 3162
114 Ga0451577_0024319 3300042876 Bacteria 5511
115 Ga0451577_0212605 3300042876 Bacteria 1747
116 Ga0453684_0005257 3300044712 Bacteria 25880
117 Ga0453684_0008903 3300044712 Bacteria 17774
118 Ga0453684_0010433 3300044712 Bacteria 15888
119 Ga0453684_0019096 3300044712 Bacteria 10463
120 Ga0453684_0170214 3300044712 Unclassified 2568
121 Ga0453684_0257550 3300044712 Unclassified 2000
122 Ga0451576_0012407 3300045051 Bacteria 9571
123 Ga0451576_0051061 3300045051 Bacteria 4336
124 Ga0451576_0184422 3300045051 Bacteria 2179
125 Ga0495586_0012241 3300046535 Bacteria 4553
126 Ga0495634_0015141 3300046642 Bacteria 5544
127 Ga0495635_0098217 3300046663 Bacteria 2002
128 Ga0495613_0003101 3300046689 Bacteria 12432
129 Ga0495660_0152010 3300046810 Bacteria 1142
130 Ga0495680_0014113 3300047322 Bacteria 6938
131 Ga0496110_0026536 3300048913 Bacteria 4959
132 Ga0496111_0185934 3300048914 Bacteria 1545
133 Ga0496112_0031108 3300048915 Bacteria 5173
134 Ga0496115_0112183 3300048918 Unclassified 2240
135 Ga0501031_0163962 3300049568 Unclassified 1453
136 Ga0501033_0136201 3300049570 Bacteria 1777
137 Ga0501033_0149774 3300049570 Bacteria 1684
138 Ga0501037_0083722 3300049573 Bacteria 2311
139 Ga0501038_0176886 3300049574 Bacteria 1724
140 Ga0501039_0041483 3300049575 Bacteria 3555
141 Ga0501040_0112636 3300049576 Bacteria 1903
142 Ga0501047_0205831 3300049581 Bacteria 1827
143 Ga0501048_0153985 3300049582 Bacteria 1626
144 Ga0501070_0013770 3300049586 Bacteria 6812
145 Ga0501070_0144175 3300049586 Bacteria 1966
146 Ga0501071_0028589 3300049587 Bacteria 3930
147 Ga0501071_0044208 3300049587 Bacteria 3195
148 Ga0501071_0054620 3300049587 Bacteria 2882
149 Ga0501071_0157258 3300049587 Bacteria 1697
150 Ga0501072_0013686 3300049588 Bacteria 6212
151 Ga0501072_0039317 3300049588 Bacteria 3714
152 Ga0501072_0074815 3300049588 Bacteria 2678
153 Ga0501076_0290716 3300049592 Bacteria 1339
154 Ga0501257_021825 3300049686 Bacteria 1512
155 Ga0501079_0107451 3300049741 Bacteria 2166
156 Ga0501044_0000714 3300049823 Bacteria 40064
157 Ga0501044_0017247 3300049823 Bacteria 7745
158 Ga0501044_0163763 3300049823 Bacteria 2199
159 Ga0501044_0201390 3300049823 Bacteria 1949
160 nmdc:mga05p37_19215_c1 3300050507 Bacteria 8266
161 nmdc:mga05p37_197721_c1 3300050507 Bacteria 2437
162 nmdc:mga05p37_29863_c1 3300050507 Bacteria 6652
163 nmdc:mga0qj67_13198_c1 3300050509 Bacteria 6235
164 nmdc:mga0qj67_30004_c1 3300050509 Bacteria 4228
165 nmdc:mga06r32_11356_c1 3300050510 Bacteria 8019
166 nmdc:mga06r32_334355_c1 3300050510 Bacteria 1500
167 nmdc:mga06r32_68790_c1 3300050510 Bacteria 3421
168 nmdc:mga08y16_143_c1 3300050511 Bacteria 7582
169 nmdc:mga08y16_261901_c1 3300050511 Unclassified 1786
170 nmdc:mga08y16_42959_c1 3300050511 Bacteria 4735
171 nmdc:mga08y16_45736_c1 3300050511 Bacteria 4585
172 nmdc:mga0a205_17884_c1 3300050515 Bacteria 6653
173 nmdc:mga0a205_8596_c1 3300050515 Bacteria 9291
174 nmdc:mga0a205_99137_c1 3300050515 Bacteria 2812
175 Ga0501084_0017876 3300054114 Bacteria 5902
176 Ga0501084_0039288 3300054114 Bacteria 3958
177 Ga0501084_0358779 3300054114 Bacteria 1232
178 Ga0501082_0342399 3300060353 Bacteria 1303
179 Ga0530510_0005199 3300061734 Bacteria 8983
180 Ga0530510_0114648 3300061734 Bacteria 1975
181 2839992573 2839989709 Bacteria 3773432
182 2910250336 2910245624 Bacteria 6935613
183 2919696581 2919692658 Bacteria 5943958
184 Ga0114129_10108368
185 JGI25151J46595_10015572
186 JGI25406J46586_10018381
187 Ga0070670_100107039
188 Ga0068868_100046839
189 Ga0068868_100298748
190 Ga0070675_100066398
191 Ga0070674_100029532
192 Ga0070674_100064844
193 Ga0070685_10026703
194 Ga0070699_100049084
195 Ga0068853_100006669
196 Ga0070672_100276382
197 Ga0070696_100000426
198 Ga0070665_100000130
199 Ga0068855_100013178
200 Ga0068857_100061434
201 Ga0068856_100184192
202 Ga0068859_100030284
203 Ga0068863_100002230
204 Ga0081455_10025823
205 Ga0081538_10015783
206 Ga0081538_10024070
207 Ga0081538_10056355
208 Ga0081539_10003142
209 Ga0075368_10009531
210 Ga0075367_10016092
211 Ga0075428_100019426
212 Ga0075428_100029859
213 Ga0075428_100219705
214 Ga0075430_100002859
215 Ga0075430_100009622
216 Ga0075430_100026431
217 Ga0075431_100010536
218 Ga0075431_100014700
219 Ga0075431_100024436
220 Ga0075431_100046534
221 Ga0075433_10112215
222 Ga0075434_100103900
223 Ga0097620_100030284
224 Ga0105240_10026468
225 Ga0105240_10112635
226 Ga0111539_10015701
227 Ga0111539_10017847
228 Ga0111539_10029472
229 Ga0111539_10273044
230 Ga0114129_10050464
231 Ga0114129_10065711
232 Ga0114129_10082007
233 Ga0105241_10046432
234 Ga0105241_10174123
235 Ga0105239_10259659
236 Ga0157369_10000746
237 Ga0157374_10125685
238 Ga0163163_10116682
239 Ga0157380_10150642
240 Ga0157379_10238496
241 Ga0209025_1000113
242 Ga0207697_10000720
243 Ga0207688_10028189
244 Ga0207707_10269128
245 Ga0207695_10096017
246 Ga0207650_10002669
247 Ga0207650_10059173
248 Ga0207659_10080813
249 Ga0207706_10272745
250 Ga0207669_10052623
251 Ga0207689_10252235
252 Ga0207667_10012088
253 Ga0207658_10190768
254 Ga0207641_10000727
255 Ga0207674_10007741
256 Ga0207675_100016718
257 Ga0207683_10254006
258 Ga0209971_1020752
259 Ga0207428_10009154
260 Ga0207428_10027692
261 Ga0207428_10162122
262 Ga0268266_10000136
263 Ga0268264_10336836
264 Ga0265338_10004945
265 Ga0265338_10021708
266 Ga0265338_10061405
267 Ga0265338_10076697
268 Ga0265320_10030468
269 Ga0265325_10029673
270 Ga0265339_10009274
271 Ga0265316_10032400
272 Ga0307408_100003146
273 Ga0307408_100014831
274 Ga0307408_100099319
275 Ga0265313_10006631
276 Ga0307405_10089910
277 Ga0307413_10026476
278 Ga0307410_10033942
279 Ga0307410_10049832
280 Ga0307410_10209721
281 Ga0307406_10036058
282 Ga0307412_10106932
283 Ga0307409_100022845
284 Ga0307409_100190439
285 Ga0307416_100026395
286 Ga0307414_10000059
287 Ga0307415_100019229
288 Ga0307415_100263406
289 Ga0307507_10070643
290 Ga0373954_0019498
291 Ga0373933_0039062
292 Ga0373937_0062765
293 Ga0316582_0160517
294 Ga0373925_0263036
295 Ga0395901_0079725
296 Ga0439450_001912
297 Ga0451577_0024319
298 Ga0451577_0212605
299 Ga0453684_0005257
300 Ga0453684_0008903
301 Ga0453684_0010433
302 Ga0453684_0019096
303 Ga0453684_0170214
304 Ga0453684_0257550
305 Ga0451576_0012407
306 Ga0451576_0051061
307 Ga0451576_0184422
308 Ga0495586_0012241
309 Ga0495634_0015141
310 Ga0495635_0098217
311 Ga0495613_0003101
312 Ga0495660_0152010
313 Ga0495680_0014113
314 Ga0496110_0026536
315 Ga0496111_0185934
316 Ga0496112_0031108
317 Ga0496115_0112183
318 Ga0501031_0163962
319 Ga0501033_0136201
320 Ga0501033_0149774
321 Ga0501037_0083722
322 Ga0501038_0176886
323 Ga0501039_0041483
324 Ga0501040_0112636
325 Ga0501047_0205831
326 Ga0501048_0153985
327 Ga0501070_0013770
328 Ga0501070_0144175
329 Ga0501071_0028589
330 Ga0501071_0044208
331 Ga0501071_0054620
332 Ga0501071_0157258
333 Ga0501072_0013686
334 Ga0501072_0039317
335 Ga0501072_0074815
336 Ga0501076_0290716
337 Ga0501257_021825
338 Ga0501079_0107451
339 Ga0501044_0000714
340 Ga0501044_0017247
341 Ga0501044_0163763
342 Ga0501044_0201390
343 nmdc:mga05p37_19215_c1
344 nmdc:mga05p37_197721_c1
345 nmdc:mga05p37_29863_c1
346 nmdc:mga0qj67_13198_c1
347 nmdc:mga0qj67_30004_c1
348 nmdc:mga06r32_11356_c1
349 nmdc:mga06r32_334355_c1
350 nmdc:mga06r32_68790_c1
351 nmdc:mga08y16_143_c1
352 nmdc:mga08y16_261901_c1
353 nmdc:mga08y16_42959_c1
354 nmdc:mga08y16_45736_c1
355 nmdc:mga0a205_17884_c1
356 nmdc:mga0a205_8596_c1
357 nmdc:mga0a205_99137_c1
358 Ga0501084_0017876
359 Ga0501084_0039288
360 Ga0501084_0358779
361 Ga0501082_0342399
362 Ga0530510_0005199
363 Ga0530510_0114648
364 2839992573
365 2910250336
366 2919696581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

63

196

0.96

PF24621

197

341

0.94

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

31

190

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p53-assembly1.cif.gz_A-2 vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. jinggangensis 5008 with nad+ and zn2+ bound 0.8861 4 380
4p53-assembly1.cif.gz_A-2 vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. jinggangensis 5008 with nad+ and zn2+ bound 0.8815 4 380
3qbd-assembly1.cif.gz_B 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with nad 0.8717 16 377
6lk2-assembly1.cif.gz_C crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.8708 16 374
3qbe-assembly1.cif.gz_A crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis 0.8706 16 377
ID Description Score Start End Superfamily
4p53A02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8986 197 380 1.20.1090.10
4p53A02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8631 197 380 1.20.1090.10
af_E7EXW6_265_468_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8496 197 384 1.20.1090.10
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8489 197 379 1.20.1090.10
5tprB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8385 8 189 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A1U9NFZ2-F1-model_v4 3-dehydroquinate synthase 0.9526 4 379 GO:0003856
GO:0009073
AF-A0A2T5P3N5-F1-model_v4 deleted 0.9517 7 383
AF-A0A7V4H262-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9516 1 329 GO:0003856
GO:0009073
AF-A0A6N6PC15-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9466 2 383 GO:0003856
GO:0009073
GO:0016020
AF-A0A357THT0-F1-model_v4 3-dehydroquinate synthase 0.9446 4 287 GO:0003856
GO:0009073

Map