F280603

General Info

Members Datasets Scaffolds Average Seq Length
183 131 175 322

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10004572|Ga0081539_100045728
Length 350
Sequence MTTAMTTSGPGPEVLTVGRVGVDLYPDVEHRPEVVGVPLEQVTGFARSLGGTATNVAVAAARLGRRAAVLTKVGPDPFGDYVRMALRGFGVDPAYVGTEPGLLTPVVFCALDPPEDPPLLFYRLPVAPDLTLTDDDVPWDVVASVPLFWVTGTGVSREPARSTQLAMLEHRGRPPTGAGTDSGDPDGARRWTVLDLDWRPMFWSGPADARREYDRMLDHVNVAVGNRAEVEVATGTSDPQEAAQRLLDRGVELAIVKRGGDGTDTVAPQRIQVVCGLGAGDAFGGALVHGLLSGWDPVACARYANAAGAIVASRLACADAMPTGAELEQALSPTPGVEQTGVPETGGVRA

Samples

Sample ID Description Type Environment
1 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
2 2739367898 Nocardioides sp. CF479 Isolate Unclassified
3 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
4 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
5 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
6 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
7 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 0
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 0
Rhizoplane 9.84
Rhizosphere 68.31
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000272 3300002077 Bacteria 8474
2 Ga0070683_100194573 3300005329 Bacteria 1925
3 Ga0070683_100279113 3300005329 Bacteria 1589
4 Ga0068869_100030214 3300005334 Bacteria 3802
5 Ga0070682_100005365 3300005337 Bacteria 7134
6 Ga0070691_10016163 3300005341 Bacteria 3429
7 Ga0070669_100102906 3300005353 Bacteria 2157
8 Ga0070674_100221492 3300005356 Bacteria 1472
9 Ga0070667_100018094 3300005367 Bacteria 5841
10 Ga0070701_10004373 3300005438 Bacteria 5712
11 Ga0070700_100019615 3300005441 Bacteria 3905
12 Ga0070708_100068960 3300005445 Bacteria 3179
13 Ga0070708_100568492 3300005445 Bacteria 1069
14 Ga0070678_100218250 3300005456 Bacteria 1584
15 Ga0070678_100461592 3300005456 Bacteria 1114
16 Ga0068867_100049761 3300005459 Bacteria 3085
17 Ga0070706_100163738 3300005467 Bacteria 2077
18 Ga0070707_100003531 3300005468 Bacteria 14758
19 Ga0070707_100206441 3300005468 Bacteria 1915
20 Ga0070698_100003872 3300005471 Bacteria 16458
21 Ga0070699_100002470 3300005518 Bacteria 16623
22 Ga0070684_100070371 3300005535 Bacteria 3078
23 Ga0070684_100361429 3300005535 Bacteria 1336
24 Ga0070684_100428197 3300005535 Bacteria 1222
25 Ga0070672_100075551 3300005543 Bacteria 2690
26 Ga0070686_100007264 3300005544 Bacteria 6173
27 Ga0070665_100112045 3300005548 Bacteria 2731
28 Ga0070704_100092445 3300005549 Bacteria 2258
29 Ga0068854_100010768 3300005578 Bacteria 5934
30 Ga0068856_100066741 3300005614 Bacteria 3555
31 Ga0070702_100000745 3300005615 Bacteria 12339
32 Ga0070702_100213510 3300005615 Bacteria 1286
33 Ga0068852_100040515 3300005616 Bacteria 3930
34 Ga0068852_100147484 3300005616 Bacteria 2184
35 Ga0068866_10048696 3300005718 Bacteria 2144
36 Ga0068861_100004921 3300005719 Bacteria 8997
37 Ga0068860_100000357 3300005843 Bacteria 60525
38 Ga0081455_10321345 3300005937 Bacteria 1102
39 Ga0081538_10000695 3300005981 Bacteria 36955
40 Ga0081538_10008404 3300005981 Bacteria 8771
41 Ga0081540_1002580 3300005983 Bacteria 14707
42 Ga0081539_10004572 3300005985 Bacteria 15117
43 Ga0081539_10007847 3300005985 Bacteria 9532
44 Ga0081539_10017079 3300005985 Bacteria 5123
45 Ga0075365_10019639 3300006038 Bacteria 4176
46 Ga0075365_10046787 3300006038 Bacteria 2842
47 Ga0075365_10049092 3300006038 Bacteria 2779
48 Ga0075365_10075633 3300006038 Bacteria 2273
49 Ga0075365_10135365 3300006038 Bacteria 1707
50 Ga0075365_10245569 3300006038 Bacteria 1257
51 Ga0075365_10317500 3300006038 Bacteria 1097
52 Ga0075368_10000054 3300006042 Bacteria 28035
53 Ga0075368_10037406 3300006042 Bacteria 1898
54 Ga0075363_100011937 3300006048 Bacteria 4174
55 Ga0075363_100017033 3300006048 Bacteria 3598
56 Ga0075363_100164355 3300006048 Bacteria 1258
57 Ga0075364_10060650 3300006051 Bacteria 2480
58 Ga0075367_10002241 3300006178 Bacteria 8740
59 Ga0075367_10008721 3300006178 Bacteria 5267
60 Ga0075367_10104544 3300006178 Bacteria 1734
61 Ga0068871_100078463 3300006358 Bacteria 2731
62 Ga0075428_100086919 3300006844 Bacteria 3410
63 Ga0075429_100153843 3300006880 Bacteria 2014
64 Ga0068865_100212174 3300006881 Bacteria 1509
65 Ga0111539_10059845 3300009094 Bacteria 4516
66 Ga0105245_10020459 3300009098 Bacteria 5804
67 Ga0105245_10159095 3300009098 Bacteria 2142
68 Ga0105243_10004098 3300009148 Bacteria 11600
69 Ga0105243_10168112 3300009148 Bacteria 1897
70 Ga0105248_10036382 3300009177 Bacteria 5505
71 Ga0105249_10025684 3300009553 Bacteria 5305
72 Ga0105246_10122790 3300011119 Bacteria 1927
73 Ga0157371_10053203 3300013102 Bacteria 2875
74 Ga0157369_10010204 3300013105 Bacteria 10717
75 Ga0157372_10079769 3300013307 Bacteria 3702
76 Ga0163163_10064519 3300014325 Bacteria 3634
77 Ga0163163_10252702 3300014325 Bacteria 1813
78 Ga0157380_10444468 3300014326 Bacteria 1243
79 Ga0207688_10003203 3300025901 Bacteria 8934
80 Ga0207646_10003840 3300025922 Bacteria 16690
81 Ga0207646_10244533 3300025922 Bacteria 1621
82 Ga0207681_10148999 3300025923 Bacteria 1751
83 Ga0207659_10036487 3300025926 Bacteria 3405
84 Ga0207687_10029842 3300025927 Bacteria 3671
85 Ga0207706_10173989 3300025933 Bacteria 1891
86 Ga0207704_10034981 3300025938 Bacteria 2873
87 Ga0207691_10000718 3300025940 Bacteria 32704
88 Ga0207711_10041630 3300025941 Bacteria 3912
89 Ga0207689_10038970 3300025942 Bacteria 3935
90 Ga0207661_10117318 3300025944 Bacteria 2261
91 Ga0207679_10084183 3300025945 Bacteria 2440
92 Ga0207712_10047294 3300025961 Bacteria 2986
93 Ga0207668_10216486 3300025972 Bacteria 1535
94 Ga0207640_10170128 3300025981 Bacteria 1623
95 Ga0207658_10019099 3300025986 Bacteria 4740
96 Ga0207677_10151095 3300026023 Bacteria 1792
97 Ga0207639_10100964 3300026041 Bacteria 2332
98 Ga0207708_10000109 3300026075 Bacteria 63095
99 Ga0207708_10192819 3300026075 Bacteria 1623
100 Ga0207702_10083726 3300026078 Bacteria 2776
101 Ga0207648_10001515 3300026089 Bacteria 25604
102 Ga0207675_100002275 3300026118 Bacteria 19081
103 Ga0207675_100339971 3300026118 Bacteria 1469
104 Ga0207683_10066594 3300026121 Bacteria 3176
105 Ga0207683_10232087 3300026121 Bacteria 1683
106 Ga0207683_10409041 3300026121 Bacteria 1249
107 Ga0207698_10058805 3300026142 Bacteria 2981
108 Ga0207698_10143985 3300026142 Bacteria 2058
109 Ga0209813_10001330 3300027866 Bacteria 5530
110 Ga0268264_10001644 3300028381 Bacteria 20647
111 Ga0265340_10004948 3300031247 Bacteria 7407
112 Ga0307513_10000135 3300031456 Bacteria 103254
113 Ga0307413_10000206 3300031824 Bacteria 17223
114 Ga0307413_10073819 3300031824 Bacteria 2158
115 Ga0307409_100032412 3300031995 Bacteria 3788
116 Ga0307409_100076891 3300031995 Bacteria 2679
117 Ga0307409_100147620 3300031995 Bacteria 2036
118 Ga0307507_10029895 3300033179 Bacteria 5762
119 Ga0307507_10122791 3300033179 Bacteria 2069
120 Ga0400483_053375 3300039062 Bacteria 3754
121 Ga0400483_118937 3300039062 Bacteria 11149
122 Ga0400483_159751 3300039062 Bacteria 2932
123 Ga0400483_162192 3300039062 Bacteria 7323
124 Ga0400483_280479 3300039062 Bacteria 2220
125 Ga0400483_286987 3300039062 Bacteria 5414
126 Ga0451797_0004837 3300041453 Bacteria 1347
127 Ga0451841_0882780 3300041498 Bacteria 2665
128 Ga0439449_0013816 3300042007 Bacteria 3037
129 Ga0466963_0009949 3300044694 Bacteria 5744
130 Ga0466957_0011486 3300044842 Bacteria 5111
131 Ga0466959_0170402 3300045049 Bacteria 1527
132 Ga0466958_0041363 3300045836 Bacteria 2772
133 Ga0466967_0030582 3300045976 Bacteria 4520
134 Ga0495641_0005527 3300046461 Bacteria 8495
135 Ga0495640_0237508 3300046533 Bacteria 1145
136 Ga0495635_0257817 3300046663 Bacteria 1175
137 Ga0495680_0166694 3300047322 Bacteria 1597
138 Ga0496100_0180883 3300048903 Bacteria 1525
139 Ga0496101_0112631 3300048904 Bacteria 2050
140 Ga0496105_0066809 3300048908 Bacteria 2969
141 Ga0496107_0149118 3300048910 Bacteria 1730
142 Ga0496108_0073501 3300048911 Bacteria 2886
143 Ga0496109_0076680 3300048912 Bacteria 3075
144 Ga0496109_0128999 3300048912 Bacteria 2359
145 Ga0496109_0186731 3300048912 Bacteria 1948
146 Ga0496110_0078747 3300048913 Bacteria 2934
147 Ga0496110_0114405 3300048913 Bacteria 2428
148 Ga0496111_0020808 3300048914 Bacteria 4573
149 Ga0496112_0038452 3300048915 Bacteria 4672
150 Ga0496114_0089065 3300048917 Bacteria 2619
151 Ga0496114_0124148 3300048917 Bacteria 2223
152 Ga0496114_0301916 3300048917 Bacteria 1414
153 Ga0496114_0337093 3300048917 Bacteria 1333
154 Ga0496114_0420703 3300048917 Bacteria 1183
155 Ga0501031_0196059 3300049568 Bacteria 1318
156 Ga0501042_0162251 3300049578 Bacteria 1613
157 Ga0501068_0038298 3300049584 Bacteria 2872
158 Ga0501072_0280798 3300049588 Bacteria 1325
159 Ga0501075_0105118 3300049591 Bacteria 2146
160 Ga0501081_0105559 3300049743 Bacteria 1996
161 Ga0501081_0203360 3300049743 Bacteria 1437
162 Ga0501044_0044029 3300049823 Bacteria 4635
163 nmdc:mga03683_11598_c1 3300050489 Bacteria 3194
164 nmdc:mga0yw44_222720_c1 3300050492 Bacteria 1251
165 nmdc:mga0yw44_35787_c1 3300050492 Bacteria 2921
166 nmdc:mga06z11_2022_c1 3300050494 Bacteria 7684
167 nmdc:mga06z11_79149_c1 3300050494 Bacteria 1759
168 nmdc:mga04h51_1335_c1 3300050495 Bacteria 5684
169 nmdc:mga04h51_52863_c1 3300050495 Bacteria 1369
170 nmdc:mga05p37_54326_c1 3300050507 Bacteria 4927
171 nmdc:mga09592_160661_c1 3300050508 Bacteria 1941
172 Ga0500616_0000145 3300053153 Bacteria 120927
173 Ga0500616_0006207 3300053153 Bacteria 7885
174 Ga0466962_0050148 3300061719 Bacteria 1995
175 Ga0530510_0150970 3300061734 Bacteria 1716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0150970 Ga0530510_0150970_865_1680 263
2 3300025933 Ga0207706_10173989 Ga0207706_101739892 295
3 3300005615 Ga0070702_100213510 Ga0070702_1002135102 299
4 3300005616 Ga0068852_100147484 Ga0068852_1001474842 300
5 3300026142 Ga0207698_10143985 Ga0207698_101439852 300
6 3300031824 Ga0307413_10000206 Ga0307413_100002066 304
7 iso_pu_bacteria 2751185734 2753069661 304
8 iso_pu_bacteria 2795385470 2795783111 304
9 iso_pu_bacteria 2899359706 2899362453 304
10 iso_pu_bacteria 8047710418 8047716292 304
11 3300005535 Ga0070684_100361429 Ga0070684_1003614292 305
12 3300005843 Ga0068860_100000357 Ga0068860_10000035749 305
13 3300028381 Ga0268264_10001644 Ga0268264_100016443 305
14 3300045049 Ga0466959_0170402 Ga0466959_0170402_445_1476 305
15 3300005614 Ga0068856_100066741 Ga0068856_1000667413 307
16 3300013105 Ga0157369_10010204 Ga0157369_100102048 307
17 3300026078 Ga0207702_10083726 Ga0207702_100837262 307
18 3300045836 Ga0466958_0041363 Ga0466958_0041363_862_1944 307
19 3300031995 Ga0307409_100147620 Ga0307409_1001476201 308
20 3300033179 Ga0307507_10122791 Ga0307507_101227912 308
21 3300042007 Ga0439449_0013816 Ga0439449_0013816_1942_2871 308
22 3300005334 Ga0068869_100030214 Ga0068869_1000302144 309
23 3300005356 Ga0070674_100221492 Ga0070674_1002214922 309
24 3300005548 Ga0070665_100112045 Ga0070665_1001120453 309
25 3300005983 Ga0081540_1002580 Ga0081540_10025809 309
26 3300025942 Ga0207689_10038970 Ga0207689_100389702 309
27 3300049578 Ga0501042_0162251 Ga0501042_0162251_348_1343 309
28 iso_pu_bacteria 2795385472 2795795605 309
29 3300049568 Ga0501031_0196059 Ga0501031_0196059_24_983 310
30 3300005985 Ga0081539_10007847 Ga0081539_100078473 311
31 iso_pu_bacteria 2870721527 2870727833 311
32 3300033179 Ga0307507_10029895 Ga0307507_100298955 312
33 3300046461 Ga0495641_0005527 Ga0495641_0005527_1963_2913 312
34 3300049743 Ga0501081_0203360 Ga0501081_0203360_185_1189 312
35 3300005985 Ga0081539_10017079 Ga0081539_100170796 313
36 3300026121 Ga0207683_10066594 Ga0207683_100665943 313
37 3300005456 Ga0070678_100461592 Ga0070678_1004615921 314
38 3300006844 Ga0075428_100086919 Ga0075428_1000869192 314
39 3300006880 Ga0075429_100153843 Ga0075429_1001538432 314
40 3300026041 Ga0207639_10100964 Ga0207639_101009642 314
41 3300039062 Ga0400483_286987 Ga0400483_286987_4447_5397 314
42 3300050507 nmdc:mga05p37_54326_c1 nmdc:mga05p37_54326_c1_1611_2618 314
43 3300050508 nmdc:mga09592_160661_c1 nmdc:mga09592_160661_c1_481_1488 314
44 3300005985 Ga0081539_10004572 Ga0081539_100045728 315
45 3300031456 Ga0307513_10000135 Ga0307513_1000013533 315
46 3300039062 Ga0400483_053375 Ga0400483_053375_2110_3069 315
47 3300039062 Ga0400483_118937 Ga0400483_118937_6296_7249 315
48 3300039062 Ga0400483_159751 Ga0400483_159751_641_1594 315
49 3300039062 Ga0400483_162192 Ga0400483_162192_75_1034 315
50 3300039062 Ga0400483_280479 Ga0400483_280479_760_1713 315
51 3300049588 Ga0501072_0280798 Ga0501072_0280798_159_1118 315
52 3300005981 Ga0081538_10000695 Ga0081538_1000069530 316
53 3300005981 Ga0081538_10008404 Ga0081538_100084048 316
54 3300026118 Ga0207675_100339971 Ga0207675_1003399712 316
55 3300005445 Ga0070708_100568492 Ga0070708_1005684921 317
56 3300005467 Ga0070706_100163738 Ga0070706_1001637382 317
57 3300005468 Ga0070707_100003531 Ga0070707_10000353113 317
58 3300005518 Ga0070699_100002470 Ga0070699_1000024701 317
59 3300006038 Ga0075365_10046787 Ga0075365_100467872 317
60 3300009098 Ga0105245_10159095 Ga0105245_101590953 317
61 3300025922 Ga0207646_10003840 Ga0207646_100038407 317
62 3300026023 Ga0207677_10151095 Ga0207677_101510952 317
63 3300026121 Ga0207683_10409041 Ga0207683_104090412 317
64 3300031247 Ga0265340_10004948 Ga0265340_100049486 317
65 3300053153 Ga0500616_0000145 Ga0500616_0000145_59382_60338 317
66 iso_pu_bacteria 2739367898 2740167374 317
67 3300006038 Ga0075365_10019639 Ga0075365_100196392 318
68 3300006038 Ga0075365_10075633 Ga0075365_100756333 318
69 3300006038 Ga0075365_10245569 Ga0075365_102455692 318
70 3300006042 Ga0075368_10037406 Ga0075368_100374062 318
71 3300006048 Ga0075363_100017033 Ga0075363_1000170333 318
72 3300006051 Ga0075364_10060650 Ga0075364_100606502 318
73 3300006178 Ga0075367_10008721 Ga0075367_100087215 318
74 3300041453 Ga0451797_0004837 Ga0451797_0004837_365_1324 318
75 3300041498 Ga0451841_0882780 Ga0451841_0882780_979_1938 318
76 3300049591 Ga0501075_0105118 Ga0501075_0105118_610_1569 318
77 3300049743 Ga0501081_0105559 Ga0501081_0105559_117_1076 318
78 3300050489 nmdc:mga03683_11598_c1 nmdc:mga03683_11598_c1_2032_3012 318
79 3300050492 nmdc:mga0yw44_35787_c1 nmdc:mga0yw44_35787_c1_1066_2058 318
80 3300050495 nmdc:mga04h51_52863_c1 nmdc:mga04h51_52863_c1_292_1284 318
81 3300053153 Ga0500616_0006207 Ga0500616_0006207_3410_4369 318
82 3300005367 Ga0070667_100018094 Ga0070667_1000180947 319
83 3300006042 Ga0075368_10000054 Ga0075368_100000544 319
84 3300006048 Ga0075363_100011937 Ga0075363_1000119372 319
85 3300006048 Ga0075363_100164355 Ga0075363_1001643552 319
86 3300006178 Ga0075367_10002241 Ga0075367_100022412 319
87 3300006178 Ga0075367_10104544 Ga0075367_101045442 319
88 3300025972 Ga0207668_10216486 Ga0207668_102164861 319
89 3300025986 Ga0207658_10019099 Ga0207658_100190992 319
90 3300027866 Ga0209813_10001330 Ga0209813_100013305 319
91 3300031995 Ga0307409_100032412 Ga0307409_1000324124 319
92 3300050494 nmdc:mga06z11_2022_c1 nmdc:mga06z11_2022_c1_5997_6959 319
93 3300050494 nmdc:mga06z11_79149_c1 nmdc:mga06z11_79149_c1_103_1065 319
94 3300050495 nmdc:mga04h51_1335_c1 nmdc:mga04h51_1335_c1_246_1208 319
95 3300005445 Ga0070708_100068960 Ga0070708_1000689604 320
96 3300005468 Ga0070707_100206441 Ga0070707_1002064412 320
97 3300005471 Ga0070698_100003872 Ga0070698_1000038725 320
98 3300006038 Ga0075365_10135365 Ga0075365_101353651 320
99 3300025922 Ga0207646_10244533 Ga0207646_102445332 320
100 3300050492 nmdc:mga0yw44_222720_c1 nmdc:mga0yw44_222720_c1_65_1039 320
101 3300005937 Ga0081455_10321345 Ga0081455_103213452 321
102 3300006038 Ga0075365_10317500 Ga0075365_103175001 321
103 3300026075 Ga0207708_10192819 Ga0207708_101928191 321
104 3300048917 Ga0496114_0089065 Ga0496114_0089065_982_1950 321
105 3300048917 Ga0496114_0337093 Ga0496114_0337093_263_1228 321
106 3300049823 Ga0501044_0044029 Ga0501044_0044029_439_1404 321
107 iso_pu_bacteria 2643221962 2645725324 321
108 3300002077 JGI24744J21845_10000272 JGI24744J21845_100002724 323
109 3300005329 Ga0070683_100194573 Ga0070683_1001945732 323
110 3300005329 Ga0070683_100279113 Ga0070683_1002791132 323
111 3300005337 Ga0070682_100005365 Ga0070682_1000053656 323
112 3300005341 Ga0070691_10016163 Ga0070691_100161632 323
113 3300005353 Ga0070669_100102906 Ga0070669_1001029062 323
114 3300005438 Ga0070701_10004373 Ga0070701_100043733 323
115 3300005441 Ga0070700_100019615 Ga0070700_1000196153 323
116 3300005456 Ga0070678_100218250 Ga0070678_1002182502 323
117 3300005459 Ga0068867_100049761 Ga0068867_1000497612 323
118 3300005535 Ga0070684_100070371 Ga0070684_1000703713 323
119 3300005535 Ga0070684_100428197 Ga0070684_1004281971 323
120 3300005543 Ga0070672_100075551 Ga0070672_1000755513 323
121 3300005544 Ga0070686_100007264 Ga0070686_1000072642 323
122 3300005549 Ga0070704_100092445 Ga0070704_1000924452 323
123 3300005578 Ga0068854_100010768 Ga0068854_1000107684 323
124 3300005615 Ga0070702_100000745 Ga0070702_1000007458 323
125 3300005616 Ga0068852_100040515 Ga0068852_1000405153 323
126 3300005718 Ga0068866_10048696 Ga0068866_100486962 323
127 3300005719 Ga0068861_100004921 Ga0068861_1000049212 323
128 3300006038 Ga0075365_10049092 Ga0075365_100490923 323
129 3300006358 Ga0068871_100078463 Ga0068871_1000784632 323
130 3300006881 Ga0068865_100212174 Ga0068865_1002121742 323
131 3300009094 Ga0111539_10059845 Ga0111539_100598454 323
132 3300009098 Ga0105245_10020459 Ga0105245_100204595 323
133 3300009148 Ga0105243_10004098 Ga0105243_100040984 323
134 3300009148 Ga0105243_10168112 Ga0105243_101681122 323
135 3300009177 Ga0105248_10036382 Ga0105248_100363825 323
136 3300009553 Ga0105249_10025684 Ga0105249_100256844 323
137 3300011119 Ga0105246_10122790 Ga0105246_101227902 323
138 3300013102 Ga0157371_10053203 Ga0157371_100532032 323
139 3300013307 Ga0157372_10079769 Ga0157372_100797692 323
140 3300014325 Ga0163163_10064519 Ga0163163_100645193 323
141 3300014325 Ga0163163_10252702 Ga0163163_102527022 323
142 3300014326 Ga0157380_10444468 Ga0157380_104444682 323
143 3300025901 Ga0207688_10003203 Ga0207688_100032037 323
144 3300025923 Ga0207681_10148999 Ga0207681_101489992 323
145 3300025926 Ga0207659_10036487 Ga0207659_100364873 323
146 3300025927 Ga0207687_10029842 Ga0207687_100298423 323
147 3300025938 Ga0207704_10034981 Ga0207704_100349812 323
148 3300025940 Ga0207691_10000718 Ga0207691_1000071829 323
149 3300025941 Ga0207711_10041630 Ga0207711_100416302 323
150 3300025944 Ga0207661_10117318 Ga0207661_101173183 323
151 3300025945 Ga0207679_10084183 Ga0207679_100841832 323
152 3300025961 Ga0207712_10047294 Ga0207712_100472943 323
153 3300025981 Ga0207640_10170128 Ga0207640_101701282 323
154 3300026075 Ga0207708_10000109 Ga0207708_1000010911 323
155 3300026089 Ga0207648_10001515 Ga0207648_100015159 323
156 3300026118 Ga0207675_100002275 Ga0207675_10000227516 323
157 3300026121 Ga0207683_10232087 Ga0207683_102320872 323
158 3300026142 Ga0207698_10058805 Ga0207698_100588053 323
159 3300031824 Ga0307413_10073819 Ga0307413_100738192 323
160 3300031995 Ga0307409_100076891 Ga0307409_1000768912 323
161 3300044694 Ga0466963_0009949 Ga0466963_0009949_2046_3020 323
162 3300044842 Ga0466957_0011486 Ga0466957_0011486_3063_4037 323
163 3300045976 Ga0466967_0030582 Ga0466967_0030582_425_1399 323
164 3300046533 Ga0495640_0237508 Ga0495640_0237508_42_1025 323
165 3300046663 Ga0495635_0257817 Ga0495635_0257817_82_1065 323
166 3300047322 Ga0495680_0166694 Ga0495680_0166694_586_1569 323
167 3300048903 Ga0496100_0180883 Ga0496100_0180883_402_1382 323
168 3300048904 Ga0496101_0112631 Ga0496101_0112631_935_1918 323
169 3300048908 Ga0496105_0066809 Ga0496105_0066809_1408_2388 323
170 3300048910 Ga0496107_0149118 Ga0496107_0149118_241_1221 323
171 3300048911 Ga0496108_0073501 Ga0496108_0073501_680_1651 323
172 3300048912 Ga0496109_0076680 Ga0496109_0076680_1003_1974 323
173 3300048912 Ga0496109_0128999 Ga0496109_0128999_1258_2238 323
174 3300048912 Ga0496109_0186731 Ga0496109_0186731_373_1356 323
175 3300048913 Ga0496110_0078747 Ga0496110_0078747_906_1886 323
176 3300048913 Ga0496110_0114405 Ga0496110_0114405_545_1525 323
177 3300048914 Ga0496111_0020808 Ga0496111_0020808_584_1564 323
178 3300048915 Ga0496112_0038452 Ga0496112_0038452_263_1243 323
179 3300048917 Ga0496114_0124148 Ga0496114_0124148_1075_2055 323
180 3300048917 Ga0496114_0301916 Ga0496114_0301916_408_1391 323
181 3300048917 Ga0496114_0420703 Ga0496114_0420703_126_1097 323
182 3300049584 Ga0501068_0038298 Ga0501068_0038298_897_1877 323
183 3300061719 Ga0466962_0050148 Ga0466962_0050148_645_1619 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

187

324

0.93

PF00294

PfkB

pfkB family carbohydrate kinase

12

173

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pl2-assembly2.cif.gz_D crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution 0.9801 4 315
3pl2-assembly2.cif.gz_D crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution 0.9738 4 315
2v78-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase 0.9367 6 317
2dcn-assembly1.cif.gz_D crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form) 0.9365 8 317
2v78-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase 0.9251 6 317
ID Description Score Start End Superfamily
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9773 7 315 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9625 7 315 3.40.1190.20
2varB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9307 6 317 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9231 6 313 3.40.1190.20
2varB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9192 6 317 3.40.1190.20
ID Description Score Start End GO Terms
AF-I2MYI5-F1-model_v4 5-dehydro-2-deoxygluconokinase 0.9754 5 318 GO:0016301
AF-A0A542Q3M9-F1-model_v4 5-dehydro-2-deoxygluconokinase 0.9731 5 318 GO:0016301
AF-A0A1M7K2Z1-F1-model_v4 5-dehydro-2-deoxygluconokinase 0.9697 5 323 GO:0016301
AF-A0A3P1SFF6-F1-model_v4 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) 0.9695 5 320 GO:0047590
AF-A0A2S8MMP5-F1-model_v4 deleted 0.9635 146 294

Feature Viewer

pLDDT pTM Quality
92.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map