F279916

General Info

Members Datasets Scaffolds Average Seq Length
182 114 176 209

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0010460|Ga0500635_0010460_1813_2490
Length 225
Sequence LITEKLYLPEITKMKKRALILDLDNTIYPVSSIADNLFGQLFKILDEHSFSINLNGDERINQIKDEMTRRPFQHIADEYQLDSEIRNKMIDTLKGMTYNLPMQPFEDYAHIRTIRLDKFLVTTGFVKLQLSKVKMLGIEQDFKSIHIVDPEVDQKTKKDVFAELIAEHGYQASELLVIGDDPESEIKAAKALGIDTFLYDPGNKYPTAEVSHRAASLEEVLAILT

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
4 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
5 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
6 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
112 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
113 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
114 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 0.55
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003494 3300001904 Unclassified 2725
2 JGI24739J22299_10013678 3300001989 Bacteria 2958
3 JGI24739J22299_10045580 3300001989 Bacteria 1438
4 JGI24739J22299_10047011 3300001989 Bacteria 1410
5 JGI24737J22298_10006971 3300001990 Bacteria 3831
6 JGI24737J22298_10066784 3300001990 Unclassified 1077
7 JGI24735J21928_10000012 3300002067 Bacteria 208921
8 JGI25157J39369_1005885 3300002741 Unclassified 1932
9 JGI25157J39369_1010269 3300002741 Unclassified 1237
10 rootH1_10050450 3300003316 Bacteria 18623
11 rootH2_10001891 3300003320 Bacteria 464318
12 rootH2_10256001 3300003320 Bacteria 1659
13 rootL2_10235148 3300003322 Bacteria 1225
14 rootL2_10235149 3300003322 Bacteria 3132
15 rootH1_10144553 3300003323 Unclassified 1484
16 Ga0065714_10013678 3300005288 Bacteria 2706
17 Ga0065714_10099549 3300005288 Bacteria 1684
18 Ga0070658_10085423 3300005327 Bacteria 2595
19 Ga0070658_10120692 3300005327 Bacteria 2178
20 Ga0070676_10000225 3300005328 Bacteria 24165
21 Ga0070680_100323469 3300005336 Bacteria 1309
22 Ga0068868_100004676 3300005338 Bacteria 9615
23 Ga0070660_100015364 3300005339 Bacteria 5525
24 Ga0070673_100003988 3300005364 Bacteria 9288
25 Ga0070659_100091726 3300005366 Unclassified 2435
26 Ga0070678_100017504 3300005456 Bacteria 4617
27 Ga0070662_100000456 3300005457 Bacteria 24198
28 Ga0068867_100003538 3300005459 Bacteria 10981
29 Ga0070679_100480816 3300005530 Unclassified 1186
30 Ga0068853_100196058 3300005539 Unclassified 1837
31 Ga0070665_100000267 3300005548 Bacteria 85526
32 Ga0068855_100000048 3300005563 Bacteria 145334
33 Ga0068855_100000506 3300005563 Bacteria 48223
34 Ga0068855_100033493 3300005563 Bacteria 6131
35 Ga0068855_100094647 3300005563 Bacteria 3444
36 Ga0068855_100207287 3300005563 Bacteria 2205
37 Ga0068855_100343202 3300005563 Unclassified 1646
38 Ga0068856_100000063 3300005614 Bacteria 99730
39 Ga0068856_100000915 3300005614 Bacteria 31569
40 Ga0068856_100033708 3300005614 Bacteria 5015
41 Ga0068852_100001292 3300005616 Bacteria 16731
42 Ga0068870_10068242 3300005840 Bacteria 1931
43 Ga0068863_100726084 3300005841 Bacteria 988
44 Ga0075366_10001586 3300006195 Bacteria 11385
45 Ga0097621_100000909 3300006237 Bacteria 20674
46 Ga0068871_100000653 3300006358 Bacteria 23842
47 Ga0068865_100000049 3300006881 Bacteria 65689
48 Ga0105240_10009012 3300009093 Bacteria 14172
49 Ga0105240_10120703 3300009093 Bacteria 3156
50 Ga0105240_10741904 3300009093 Bacteria 1068
51 Ga0105243_10070660 3300009148 Bacteria 2820
52 Ga0105241_10000289 3300009174 Bacteria 37443
53 Ga0105241_10062061 3300009174 Bacteria 2880
54 Ga0105241_10094949 3300009174 Bacteria 2360
55 Ga0105242_10034818 3300009176 Bacteria 4037
56 Ga0105242_10714316 3300009176 Unclassified 982
57 Ga0105237_10001979 3300009545 Bacteria 26062
58 Ga0105237_10004376 3300009545 Bacteria 16371
59 Ga0105239_10007238 3300010375 Bacteria 12748
60 Ga0157371_10112808 3300013102 Bacteria 1930
61 Ga0157370_10126925 3300013104 Bacteria 2381
62 Ga0157369_10055621 3300013105 Bacteria 4271
63 Ga0157369_10088129 3300013105 Bacteria 3313
64 Ga0157374_10001329 3300013296 Bacteria 21015
65 Ga0157374_10004451 3300013296 Bacteria 11775
66 Ga0163162_10000074 3300013306 Bacteria 91138
67 Ga0163162_10007261 3300013306 Bacteria 10760
68 Ga0157372_10001217 3300013307 Bacteria 27846
69 Ga0157372_10121887 3300013307 Unclassified 2996
70 Ga0157372_10208900 3300013307 Bacteria 2262
71 Ga0157375_10148756 3300013308 Bacteria 2475
72 Ga0157377_10253869 3300014745 Unclassified 1141
73 Ga0163161_10147866 3300017792 Bacteria 1784
74 Ga0213872_10002568 3300021361 Bacteria 10582
75 Ga0209026_1000602 3300025250 Bacteria 23171
76 Ga0209026_1001290 3300025250 Bacteria 11368
77 Ga0209026_1008167 3300025250 Bacteria 2225
78 Ga0207647_10000351 3300025904 Bacteria 37260
79 Ga0207645_10000415 3300025907 Bacteria 35412
80 Ga0207705_10090596 3300025909 Bacteria 2239
81 Ga0207705_10223883 3300025909 Bacteria 1429
82 Ga0207654_10000553 3300025911 Bacteria 21232
83 Ga0207654_10033072 3300025911 Bacteria 2864
84 Ga0207654_10364940 3300025911 Bacteria 997
85 Ga0207695_10010040 3300025913 Bacteria 11625
86 Ga0207695_10042858 3300025913 Bacteria 4828
87 Ga0207695_10106511 3300025913 Bacteria 2789
88 Ga0207671_10000807 3300025914 Bacteria 39591
89 Ga0207671_10040961 3300025914 Bacteria 3428
90 Ga0207652_10341900 3300025921 Unclassified 1351
91 Ga0207694_10025902 3300025924 Bacteria 4459
92 Ga0207690_10193280 3300025932 Unclassified 1540
93 Ga0207706_10000043 3300025933 Bacteria 124186
94 Ga0207709_10041648 3300025935 Bacteria 2757
95 Ga0207704_10000057 3300025938 Bacteria 78383
96 Ga0207667_10000023 3300025949 Bacteria 362527
97 Ga0207667_10001511 3300025949 Bacteria 29216
98 Ga0207667_10027250 3300025949 Bacteria 6224
99 Ga0207667_10148141 3300025949 Bacteria 2416
100 Ga0207667_10189246 3300025949 Bacteria 2112
101 Ga0207667_10300933 3300025949 Unclassified 1639
102 Ga0207651_10002891 3300025960 Bacteria 8286
103 Ga0207677_10007120 3300026023 Bacteria 6158
104 Ga0207639_10103251 3300026041 Unclassified 2309
105 Ga0207702_10000422 3300026078 Bacteria 48511
106 Ga0207702_10046226 3300026078 Bacteria 3664
107 Ga0207702_10061733 3300026078 Unclassified 3198
108 Ga0207641_10469809 3300026088 Unclassified 1218
109 Ga0207648_10002065 3300026089 Bacteria 21891
110 Ga0207683_10294681 3300026121 Bacteria 1484
111 Ga0207698_10001807 3300026142 Bacteria 12501
112 Ga0207698_10650592 3300026142 Unclassified 1044
113 Ga0268266_10000018 3300028379 Bacteria 569141
114 Ga0307517_10005780 3300028786 Bacteria 18503
115 Ga0307515_10001823 3300028794 Bacteria 47533
116 Ga0307515_10002477 3300028794 Bacteria 40143
117 Ga0307414_10322651 3300032004 Bacteria 1315
118 Ga0307414_10384455 3300032004 Bacteria 1214
119 Ga0307507_10000015 3300033179 Bacteria 237419
120 Ga0307510_10001704 3300033180 Bacteria 24421
121 Ga0395899_0000497 3300037312 Bacteria 43809
122 Ga0395899_0314627 3300037312 Bacteria 1056
123 Ga0395900_0000231 3300037418 Bacteria 87314
124 Ga0395900_0000585 3300037418 Bacteria 50049
125 Ga0395900_0041488 3300037418 Bacteria 4744
126 Ga0395900_0817056 3300037418 Bacteria 859
127 Ga0395905_0000261 3300037471 Bacteria 78643
128 Ga0395905_0002232 3300037471 Bacteria 21850
129 Ga0395901_0000236 3300038443 Bacteria 69250
130 Ga0395901_0020560 3300038443 Bacteria 6755
131 Ga0436361_0002729 3300039447 Bacteria 12014
132 Ga0495592_0419677 3300046454 Unclassified 844
133 Ga0495629_0094869 3300046459 Bacteria 2082
134 Ga0495650_0000013 3300046471 Bacteria 611135
135 Ga0495585_0001088 3300046492 Bacteria 22366
136 Ga0495585_0001853 3300046492 Bacteria 15991
137 Ga0495583_0007400 3300046506 Bacteria 6910
138 Ga0495606_0000010 3300046507 Bacteria 299893
139 Ga0495606_0008205 3300046507 Bacteria 9134
140 Ga0495606_0037269 3300046507 Bacteria 3304
141 Ga0495606_0268913 3300046507 Bacteria 937
142 Ga0495606_0273636 3300046507 Bacteria 927
143 Ga0495610_0002710 3300046512 Bacteria 14586
144 Ga0495610_0126487 3300046512 Bacteria 1114
145 Ga0495616_0012194 3300046513 Bacteria 4891
146 Ga0495616_0025214 3300046513 Bacteria 3180
147 Ga0495616_0195431 3300046513 Bacteria 892
148 Ga0495632_0217912 3300046519 Bacteria 864
149 Ga0495642_0067665 3300046528 Bacteria 1490
150 Ga0495609_0030531 3300046538 Bacteria 2453
151 Ga0495622_0088060 3300046557 Bacteria 1427
152 Ga0495633_0000337 3300046558 Bacteria 52614
153 Ga0495668_0000003 3300046616 Bacteria 695023
154 Ga0495625_0000100 3300046660 Bacteria 139983
155 Ga0495625_0001346 3300046660 Bacteria 30375
156 Ga0495625_0002354 3300046660 Bacteria 20604
157 Ga0495625_0034063 3300046660 Bacteria 3760
158 Ga0495625_0118526 3300046660 Bacteria 1803
159 Ga0495625_0427047 3300046660 Bacteria 823
160 Ga0495661_0023213 3300046665 Bacteria 4027
161 Ga0495661_0023490 3300046665 Bacteria 4002
162 Ga0495661_0044622 3300046665 Bacteria 2716
163 Ga0495661_0156380 3300046665 Bacteria 1227
164 Ga0495658_0061151 3300046683 Bacteria 2162
165 Ga0495649_0000002 3300046694 Bacteria 1093458
166 Ga0495660_0062253 3300046810 Bacteria 2001
167 Ga0495687_001817 3300047443 Bacteria 18766
168 Ga0495687_009864 3300047443 Bacteria 5291
169 Ga0495687_095462 3300047443 Bacteria 1128
170 Ga0495673_0094103 3300047469 Bacteria 1220
171 Ga0495686_0102132 3300047472 Bacteria 1728
172 nmdc:mga0k408_759_c1 3300050493 Bacteria 17745
173 Ga0500635_0010460 3300053080 Bacteria 2607
174 Ga0500608_000936 3300053122 Bacteria 10445
175 Ga0500642_0069406 3300053130 Bacteria 1600
176 Ga0500624_000474 3300053157 Bacteria 11954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10050450 rootH1_100504509 181
2 iso_pu_bacteria 2958512119 2958514775 201
3 3300046507 Ga0495606_0268913 Ga0495606_0268913_233_859 204
4 3300046513 Ga0495616_0025214 Ga0495616_0025214_1363_1986 204
5 3300046528 Ga0495642_0067665 Ga0495642_0067665_246_863 204
6 3300046660 Ga0495625_0034063 Ga0495625_0034063_897_1520 204
7 iso_pu_bacteria 2599185184 2599477845 204
8 iso_pu_bacteria 2928078545 2928079763 204
9 iso_pu_bacteria 2928147474 2928147761 204
10 iso_pu_bacteria 2932082852 2932083809 204
11 iso_pu_bacteria 2977232053 2977236699 204
12 3300002741 JGI25157J39369_1005885 JGI25157J39369_10058853 205
13 3300005563 Ga0068855_100000048 Ga0068855_100000048112 205
14 3300025250 Ga0209026_1000602 Ga0209026_100060223 205
15 3300025949 Ga0207667_10000023 Ga0207667_1000002346 205
16 3300026142 Ga0207698_10650592 Ga0207698_106505921 205
17 3300009093 Ga0105240_10120703 Ga0105240_101207032 206
18 3300025913 Ga0207695_10042858 Ga0207695_100428584 206
19 3300032004 Ga0307414_10322651 Ga0307414_103226511 206
20 3300046507 Ga0495606_0037269 Ga0495606_0037269_2312_2938 206
21 3300046665 Ga0495661_0023213 Ga0495661_0023213_3201_3824 206
22 3300046665 Ga0495661_0023490 Ga0495661_0023490_2449_3072 206
23 3300046810 Ga0495660_0062253 Ga0495660_0062253_413_1039 206
24 3300002741 JGI25157J39369_1010269 JGI25157J39369_10102692 207
25 3300005327 Ga0070658_10085423 Ga0070658_100854233 207
26 3300005614 Ga0068856_100000063 Ga0068856_10000006328 207
27 3300013306 Ga0163162_10007261 Ga0163162_100072615 207
28 3300025250 Ga0209026_1008167 Ga0209026_10081673 207
29 3300025909 Ga0207705_10090596 Ga0207705_100905962 207
30 3300026078 Ga0207702_10000422 Ga0207702_1000042223 207
31 3300032004 Ga0307414_10384455 Ga0307414_103844552 207
32 3300046506 Ga0495583_0007400 Ga0495583_0007400_5176_5805 207
33 3300046660 Ga0495625_0000100 Ga0495625_0000100_127439_128068 207
34 3300046665 Ga0495661_0156380 Ga0495661_0156380_93_722 207
35 3300046694 Ga0495649_0000002 Ga0495649_0000002_243388_244017 207
36 3300047443 Ga0495687_009864 Ga0495687_009864_1519_2148 207
37 3300047469 Ga0495673_0094103 Ga0495673_0094103_113_742 207
38 3300047472 Ga0495686_0102132 Ga0495686_0102132_1002_1631 207
39 3300001989 JGI24739J22299_10013678 JGI24739J22299_100136782 208
40 3300001989 JGI24739J22299_10045580 JGI24739J22299_100455802 208
41 3300001989 JGI24739J22299_10047011 JGI24739J22299_100470112 208
42 3300001990 JGI24737J22298_10006971 JGI24737J22298_100069715 208
43 3300002067 JGI24735J21928_10000012 JGI24735J21928_1000001250 208
44 3300003320 rootH2_10256001 rootH2_102560012 208
45 3300003322 rootL2_10235148 rootL2_102351482 208
46 3300003322 rootL2_10235149 rootL2_102351493 208
47 3300005288 Ga0065714_10013678 Ga0065714_100136783 208
48 3300005288 Ga0065714_10099549 Ga0065714_100995492 208
49 3300005563 Ga0068855_100000506 Ga0068855_10000050618 208
50 3300005563 Ga0068855_100033493 Ga0068855_1000334934 208
51 3300005614 Ga0068856_100033708 Ga0068856_1000337086 208
52 3300006195 Ga0075366_10001586 Ga0075366_100015865 208
53 3300013102 Ga0157371_10112808 Ga0157371_101128082 208
54 3300013104 Ga0157370_10126925 Ga0157370_101269251 208
55 3300013105 Ga0157369_10055621 Ga0157369_100556212 208
56 3300013307 Ga0157372_10001217 Ga0157372_1000121710 208
57 3300017792 Ga0163161_10147866 Ga0163161_101478662 208
58 3300025250 Ga0209026_1001290 Ga0209026_10012904 208
59 3300025949 Ga0207667_10001511 Ga0207667_1000151115 208
60 3300025949 Ga0207667_10027250 Ga0207667_100272504 208
61 3300026078 Ga0207702_10046226 Ga0207702_100462266 208
62 3300028794 Ga0307515_10001823 Ga0307515_100018232 208
63 3300028794 Ga0307515_10002477 Ga0307515_1000247742 208
64 3300033179 Ga0307507_10000015 Ga0307507_10000015159 208
65 3300046454 Ga0495592_0419677 Ga0495592_0419677_190_816 208
66 3300046459 Ga0495629_0094869 Ga0495629_0094869_1344_1970 208
67 3300046471 Ga0495650_0000013 Ga0495650_0000013_123521_124153 208
68 3300046492 Ga0495585_0001088 Ga0495585_0001088_7656_8282 208
69 3300046492 Ga0495585_0001853 Ga0495585_0001853_6161_6787 208
70 3300046507 Ga0495606_0000010 Ga0495606_0000010_17621_18247 208
71 3300046507 Ga0495606_0008205 Ga0495606_0008205_7807_8445 208
72 3300046512 Ga0495610_0002710 Ga0495610_0002710_12006_12638 208
73 3300046512 Ga0495610_0126487 Ga0495610_0126487_116_742 208
74 3300046513 Ga0495616_0012194 Ga0495616_0012194_3764_4390 208
75 3300046513 Ga0495616_0195431 Ga0495616_0195431_207_833 208
76 3300046519 Ga0495632_0217912 Ga0495632_0217912_88_720 208
77 3300046538 Ga0495609_0030531 Ga0495609_0030531_74_706 208
78 3300046557 Ga0495622_0088060 Ga0495622_0088060_613_1239 208
79 3300046558 Ga0495633_0000337 Ga0495633_0000337_13892_14518 208
80 3300046616 Ga0495668_0000003 Ga0495668_0000003_462075_462701 208
81 3300046660 Ga0495625_0001346 Ga0495625_0001346_6236_6862 208
82 3300046660 Ga0495625_0002354 Ga0495625_0002354_2881_3507 208
83 3300046660 Ga0495625_0118526 Ga0495625_0118526_782_1408 208
84 3300046660 Ga0495625_0427047 Ga0495625_0427047_14_640 208
85 3300046665 Ga0495661_0044622 Ga0495661_0044622_133_765 208
86 3300046683 Ga0495658_0061151 Ga0495658_0061151_798_1424 208
87 3300047443 Ga0495687_095462 Ga0495687_095462_419_1045 208
88 3300050493 nmdc:mga0k408_759_c1 nmdc:mga0k408_759_c1_10509_11135 208
89 3300053157 Ga0500624_000474 Ga0500624_000474_8598_9224 208
90 3300003320 rootH2_10001891 rootH2_10001891335 210
91 3300028786 Ga0307517_10005780 Ga0307517_1000578012 210
92 3300033180 Ga0307510_10001704 Ga0307510_1000170417 210
93 3300037312 Ga0395899_0000497 Ga0395899_0000497_972_1604 210
94 3300037418 Ga0395900_0000231 Ga0395900_0000231_42206_42838 210
95 3300037418 Ga0395900_0000585 Ga0395900_0000585_8159_8791 210
96 3300037418 Ga0395900_0817056 Ga0395900_0817056_113_745 210
97 3300037471 Ga0395905_0000261 Ga0395905_0000261_42200_42832 210
98 3300038443 Ga0395901_0000236 Ga0395901_0000236_26701_27333 210
99 3300046507 Ga0495606_0273636 Ga0495606_0273636_196_828 210
100 3300001904 JGI24736J21556_1003494 JGI24736J21556_10034943 211
101 3300001990 JGI24737J22298_10066784 JGI24737J22298_100667841 211
102 3300003323 rootH1_10144553 rootH1_101445532 211
103 3300005327 Ga0070658_10120692 Ga0070658_101206923 211
104 3300005328 Ga0070676_10000225 Ga0070676_1000022510 211
105 3300005336 Ga0070680_100323469 Ga0070680_1003234692 211
106 3300005338 Ga0068868_100004676 Ga0068868_1000046769 211
107 3300005339 Ga0070660_100015364 Ga0070660_1000153642 211
108 3300005364 Ga0070673_100003988 Ga0070673_1000039886 211
109 3300005366 Ga0070659_100091726 Ga0070659_1000917263 211
110 3300005456 Ga0070678_100017504 Ga0070678_1000175044 211
111 3300005457 Ga0070662_100000456 Ga0070662_10000045617 211
112 3300005459 Ga0068867_100003538 Ga0068867_1000035386 211
113 3300005530 Ga0070679_100480816 Ga0070679_1004808162 211
114 3300005539 Ga0068853_100196058 Ga0068853_1001960582 211
115 3300005548 Ga0070665_100000267 Ga0070665_1000002676 211
116 3300005563 Ga0068855_100094647 Ga0068855_1000946473 211
117 3300005563 Ga0068855_100207287 Ga0068855_1002072872 211
118 3300005563 Ga0068855_100343202 Ga0068855_1003432022 211
119 3300005614 Ga0068856_100000915 Ga0068856_1000009155 211
120 3300005616 Ga0068852_100001292 Ga0068852_10000129215 211
121 3300005840 Ga0068870_10068242 Ga0068870_100682422 211
122 3300005841 Ga0068863_100726084 Ga0068863_1007260842 211
123 3300006237 Ga0097621_100000909 Ga0097621_10000090920 211
124 3300006358 Ga0068871_100000653 Ga0068871_10000065325 211
125 3300006881 Ga0068865_100000049 Ga0068865_10000004912 211
126 3300009093 Ga0105240_10009012 Ga0105240_100090122 211
127 3300009093 Ga0105240_10741904 Ga0105240_107419042 211
128 3300009148 Ga0105243_10070660 Ga0105243_100706602 211
129 3300009174 Ga0105241_10000289 Ga0105241_100002892 211
130 3300009174 Ga0105241_10062061 Ga0105241_100620612 211
131 3300009174 Ga0105241_10094949 Ga0105241_100949492 211
132 3300009176 Ga0105242_10034818 Ga0105242_100348184 211
133 3300009176 Ga0105242_10714316 Ga0105242_107143162 211
134 3300009545 Ga0105237_10001979 Ga0105237_1000197918 211
135 3300009545 Ga0105237_10004376 Ga0105237_100043767 211
136 3300010375 Ga0105239_10007238 Ga0105239_100072385 211
137 3300013105 Ga0157369_10088129 Ga0157369_100881293 211
138 3300013296 Ga0157374_10001329 Ga0157374_1000132910 211
139 3300013296 Ga0157374_10004451 Ga0157374_100044519 211
140 3300013306 Ga0163162_10000074 Ga0163162_1000007469 211
141 3300013307 Ga0157372_10121887 Ga0157372_101218872 211
142 3300013307 Ga0157372_10208900 Ga0157372_102089002 211
143 3300013308 Ga0157375_10148756 Ga0157375_101487562 211
144 3300014745 Ga0157377_10253869 Ga0157377_102538691 211
145 3300021361 Ga0213872_10002568 Ga0213872_1000256810 211
146 3300025904 Ga0207647_10000351 Ga0207647_100003512 211
147 3300025907 Ga0207645_10000415 Ga0207645_1000041524 211
148 3300025909 Ga0207705_10223883 Ga0207705_102238832 211
149 3300025911 Ga0207654_10000553 Ga0207654_100005532 211
150 3300025911 Ga0207654_10033072 Ga0207654_100330722 211
151 3300025911 Ga0207654_10364940 Ga0207654_103649402 211
152 3300025913 Ga0207695_10010040 Ga0207695_100100407 211
153 3300025913 Ga0207695_10106511 Ga0207695_101065113 211
154 3300025914 Ga0207671_10000807 Ga0207671_1000080712 211
155 3300025914 Ga0207671_10040961 Ga0207671_100409613 211
156 3300025921 Ga0207652_10341900 Ga0207652_103419002 211
157 3300025924 Ga0207694_10025902 Ga0207694_100259022 211
158 3300025932 Ga0207690_10193280 Ga0207690_101932803 211
159 3300025933 Ga0207706_10000043 Ga0207706_1000004346 211
160 3300025935 Ga0207709_10041648 Ga0207709_100416482 211
161 3300025938 Ga0207704_10000057 Ga0207704_1000005750 211
162 3300025949 Ga0207667_10148141 Ga0207667_101481413 211
163 3300025949 Ga0207667_10189246 Ga0207667_101892463 211
164 3300025949 Ga0207667_10300933 Ga0207667_103009332 211
165 3300025960 Ga0207651_10002891 Ga0207651_100028917 211
166 3300026023 Ga0207677_10007120 Ga0207677_100071205 211
167 3300026041 Ga0207639_10103251 Ga0207639_101032512 211
168 3300026078 Ga0207702_10061733 Ga0207702_100617334 211
169 3300026088 Ga0207641_10469809 Ga0207641_104698092 211
170 3300026089 Ga0207648_10002065 Ga0207648_100020658 211
171 3300026121 Ga0207683_10294681 Ga0207683_102946812 211
172 3300026142 Ga0207698_10001807 Ga0207698_1000180710 211
173 3300028379 Ga0268266_10000018 Ga0268266_10000018413 211
174 3300037312 Ga0395899_0314627 Ga0395899_0314627_330_965 211
175 3300037418 Ga0395900_0041488 Ga0395900_0041488_502_1137 211
176 3300037471 Ga0395905_0002232 Ga0395905_0002232_9549_10184 211
177 3300038443 Ga0395901_0020560 Ga0395901_0020560_1636_2271 211
178 3300039447 Ga0436361_0002729 Ga0436361_0002729_2073_2708 211
179 3300047443 Ga0495687_001817 Ga0495687_001817_1675_2310 211
180 3300053080 Ga0500635_0010460 Ga0500635_0010460_1813_2490 211
181 3300053122 Ga0500608_000936 Ga0500608_000936_3247_3885 211
182 3300053130 Ga0500642_0069406 Ga0500642_0069406_15_650 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

152

222

0.85

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

19

199

0.85

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

16

193

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rme-assembly1.cif.gz_C structure of imp bound plasmodium falciparum imp-nucleotidase mutant d172n 0.7278 141 210
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.7218 140 210
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.7186 140 210
2nyv-assembly1.cif.gz_A x-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus 0.7128 2 210
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.7074 2 211
ID Description Score Start End Superfamily
af_Q8SXC9_203_298_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8206 143 184 3.40.50.1000
3vayB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8198 1 210 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8123 95 184 3.40.50.1000
af_Q9BI82_131_243_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8081 95 203 3.40.50.1000
af_Q9VYT0_202_295_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7969 144 205 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A367GS87-F1-model_v4 HAD family hydrolase 0.9837 1 210 GO:0016787
AF-A0A2U2PK39-F1-model_v4 HAD family hydrolase 0.9831 1 211 GO:0016791
AF-A0A7K1Y0Z0-F1-model_v4 HAD hydrolase-like protein 0.9827 1 210 GO:0016787
AF-A0A495T460-F1-model_v4 deleted 0.9806 1 210
AF-A0A2U2PK39-F1-model_v4 HAD family hydrolase 0.9785 1 211 GO:0016791

Feature Viewer

pLDDT pTM Quality
93.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map