F279612
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 182 | 36 | 364 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0017469|Ga0453684_0017469_8364_8891 |
| Length | 175 |
| Sequence | MDINETICRPDRSGLPRRSAMKGNTKIIDHLNLRLAEELTAINQYMVHSEMCDNWNYEKLHKMIEKRAIDEMKHAEKLIARILFLEGRPIVSDLNKMHIGPEVPKMHENDRKAEESAIMGYNESIRLAVEVGDNGTRELLEAILKDEEAHIDLIEAQLDQIKQMGVQNYLVEQID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 5 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 6 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 7 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 8 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 9 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 10 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 11 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 12 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 13 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 14 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 15 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 16 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 17 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 18 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 19 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 20 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 21 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 25 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 26 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 27 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 28 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 29 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 30 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 31 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 32 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 33 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 34 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 35 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.6 |
| Metatranscriptomes | 4.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0017469 | 3300044712 | Bacteria | 11112 |
| 2 | Ga0065707_10183482 | 3300005295 | Unclassified | 1403 |
| 3 | Ga0070708_100021743 | 3300005445 | Bacteria | 5431 |
| 4 | Ga0114129_10890223 | 3300009147 | Bacteria | 1129 |
| 5 | Ga0114129_11891595 | 3300009147 | Bacteria | 724 |
| 6 | Ga0265318_10019755 | 3300028577 | Bacteria | 2729 |
| 7 | Ga0265323_10142088 | 3300028653 | Bacteria | 772 |
| 8 | Ga0265322_10087369 | 3300028654 | Bacteria | 885 |
| 9 | Ga0265330_10132113 | 3300031235 | Bacteria | 1062 |
| 10 | Ga0265316_10001165 | 3300031344 | Bacteria | 28417 |
| 11 | Ga0265316_10004400 | 3300031344 | Bacteria | 14032 |
| 12 | Ga0265316_10030548 | 3300031344 | Bacteria | 4414 |
| 13 | Ga0307509_10555257 | 3300031507 | Bacteria | 826 |
| 14 | Ga0307408_100305319 | 3300031548 | Bacteria | 1335 |
| 15 | Ga0316575_10001685 | 3300031665 | Bacteria | 7226 |
| 16 | Ga0316575_10001800 | 3300031665 | Bacteria | 7020 |
| 17 | Ga0316575_10045163 | 3300031665 | Bacteria | 1749 |
| 18 | Ga0316575_10319645 | 3300031665 | Bacteria | 658 |
| 19 | Ga0316579_10004141 | 3300031691 | Bacteria | 5733 |
| 20 | Ga0316579_10007275 | 3300031691 | Bacteria | 4564 |
| 21 | Ga0316579_10016741 | 3300031691 | Bacteria | 3207 |
| 22 | Ga0316579_10016785 | 3300031691 | Bacteria | 3203 |
| 23 | Ga0316579_10019138 | 3300031691 | Bacteria | 3022 |
| 24 | Ga0316579_10041684 | 3300031691 | Bacteria | 2131 |
| 25 | Ga0316579_10051607 | 3300031691 | Bacteria | 1925 |
| 26 | Ga0316579_10098138 | 3300031691 | Unclassified | 1402 |
| 27 | Ga0316579_10308985 | 3300031691 | Bacteria | 764 |
| 28 | Ga0265342_10024821 | 3300031712 | Unclassified | 3779 |
| 29 | Ga0265342_10137426 | 3300031712 | Bacteria | 1365 |
| 30 | Ga0316576_10064568 | 3300031727 | Bacteria | 2689 |
| 31 | Ga0316576_10084913 | 3300031727 | Unclassified | 2353 |
| 32 | Ga0316576_10173218 | 3300031727 | Bacteria | 1629 |
| 33 | Ga0316576_10178392 | 3300031727 | Bacteria | 1602 |
| 34 | Ga0316576_10364629 | 3300031727 | Bacteria | 1074 |
| 35 | Ga0316576_10416217 | 3300031727 | Bacteria | 995 |
| 36 | Ga0316576_10761251 | 3300031727 | Bacteria | 699 |
| 37 | Ga0316578_10001132 | 3300031728 | Bacteria | 10446 |
| 38 | Ga0316578_10057778 | 3300031728 | Bacteria | 2280 |
| 39 | Ga0316578_10245003 | 3300031728 | Bacteria | 1076 |
| 40 | Ga0316578_10247388 | 3300031728 | Bacteria | 1070 |
| 41 | Ga0316578_10276785 | 3300031728 | Bacteria | 1005 |
| 42 | Ga0316577_10000148 | 3300031733 | Bacteria | 21440 |
| 43 | Ga0316577_10000200 | 3300031733 | Bacteria | 20047 |
| 44 | Ga0316577_10000373 | 3300031733 | Bacteria | 16938 |
| 45 | Ga0316577_10000703 | 3300031733 | Bacteria | 14178 |
| 46 | Ga0316577_10001744 | 3300031733 | Bacteria | 10463 |
| 47 | Ga0316577_10002009 | 3300031733 | Bacteria | 9916 |
| 48 | Ga0316577_10011480 | 3300031733 | Bacteria | 4800 |
| 49 | Ga0316577_10013587 | 3300031733 | Bacteria | 4457 |
| 50 | Ga0316577_10070313 | 3300031733 | Unclassified | 1954 |
| 51 | Ga0316577_10097745 | 3300031733 | Unclassified | 1645 |
| 52 | Ga0316577_10443218 | 3300031733 | Unclassified | 738 |
| 53 | Ga0316577_10461715 | 3300031733 | Unclassified | 722 |
| 54 | Ga0307416_100635072 | 3300032002 | Bacteria | 1151 |
| 55 | Ga0316585_10055990 | 3300032137 | Bacteria | 1269 |
| 56 | Ga0316585_10091173 | 3300032137 | Bacteria | 996 |
| 57 | Ga0316580_10158679 | 3300032139 | Bacteria | 694 |
| 58 | Ga0316593_10114063 | 3300032168 | Bacteria | 966 |
| 59 | Ga0316593_10141225 | 3300032168 | Bacteria | 872 |
| 60 | Ga0316593_10155844 | 3300032168 | Unclassified | 832 |
| 61 | Ga0316593_10253275 | 3300032168 | Bacteria | 659 |
| 62 | Ga0316593_10330713 | 3300032168 | Bacteria | 581 |
| 63 | Ga0316588_1200347 | 3300033528 | Bacteria | 522 |
| 64 | Ga0316596_1125746 | 3300033541 | Unclassified | 699 |
| 65 | Ga0316596_1173418 | 3300033541 | Bacteria | 596 |
| 66 | Ga0373932_0014399 | 3300035112 | Bacteria | 1988 |
| 67 | Ga0316574_0006256 | 3300035398 | Bacteria | 6417 |
| 68 | Ga0316574_0156071 | 3300035398 | Unclassified | 1470 |
| 69 | Ga0316574_0384280 | 3300035398 | Bacteria | 885 |
| 70 | Ga0316582_0000027 | 3300036647 | Bacteria | 34800 |
| 71 | Ga0316582_0000285 | 3300036647 | Bacteria | 17381 |
| 72 | Ga0316582_0001257 | 3300036647 | Bacteria | 10947 |
| 73 | Ga0316582_0002568 | 3300036647 | Bacteria | 8598 |
| 74 | Ga0316582_0004448 | 3300036647 | Bacteria | 7087 |
| 75 | Ga0316582_0024452 | 3300036647 | Unclassified | 3615 |
| 76 | Ga0316582_0026479 | 3300036647 | Bacteria | 3492 |
| 77 | Ga0316582_0038929 | 3300036647 | Bacteria | 2958 |
| 78 | Ga0316582_0039018 | 3300036647 | Bacteria | 2955 |
| 79 | Ga0316582_0088392 | 3300036647 | Bacteria | 2035 |
| 80 | Ga0316582_0291208 | 3300036647 | Bacteria | 1121 |
| 81 | Ga0316582_0303156 | 3300036647 | Bacteria | 1098 |
| 82 | Ga0316582_0343668 | 3300036647 | Bacteria | 1026 |
| 83 | Ga0316582_0437492 | 3300036647 | Bacteria | 901 |
| 84 | Ga0316582_0538967 | 3300036647 | Unclassified | 804 |
| 85 | Ga0316582_0549854 | 3300036647 | Unclassified | 795 |
| 86 | Ga0316582_0917946 | 3300036647 | Bacteria | 599 |
| 87 | Ga0316584_0000049 | 3300036712 | Bacteria | 43825 |
| 88 | Ga0316584_0000400 | 3300036712 | Bacteria | 22577 |
| 89 | Ga0316584_0004818 | 3300036712 | Bacteria | 8968 |
| 90 | Ga0316584_0023013 | 3300036712 | Bacteria | 4549 |
| 91 | Ga0316584_0030454 | 3300036712 | Bacteria | 3986 |
| 92 | Ga0316584_0039825 | 3300036712 | Bacteria | 3499 |
| 93 | Ga0316584_0041717 | 3300036712 | Bacteria | 3421 |
| 94 | Ga0316584_0096969 | 3300036712 | Bacteria | 2208 |
| 95 | Ga0316584_0115278 | 3300036712 | Bacteria | 2010 |
| 96 | Ga0316584_0191615 | 3300036712 | Bacteria | 1511 |
| 97 | Ga0316584_0349829 | 3300036712 | Bacteria | 1061 |
| 98 | Ga0316584_0478432 | 3300036712 | Unclassified | 877 |
| 99 | Ga0316584_0498279 | 3300036712 | Bacteria | 856 |
| 100 | Ga0316581_0000083 | 3300037588 | Bacteria | 12132 |
| 101 | Ga0316581_0002515 | 3300037588 | Bacteria | 4402 |
| 102 | Ga0316581_0003690 | 3300037588 | Bacteria | 3834 |
| 103 | Ga0316581_0005886 | 3300037588 | Unclassified | 3223 |
| 104 | Ga0316581_0007851 | 3300037588 | Bacteria | 2884 |
| 105 | Ga0316581_0012666 | 3300037588 | Bacteria | 2377 |
| 106 | Ga0316581_0015755 | 3300037588 | Bacteria | 2165 |
| 107 | Ga0316581_0039343 | 3300037588 | Bacteria | 1439 |
| 108 | Ga0316581_0145410 | 3300037588 | Bacteria | 731 |
| 109 | Ga0451577_0000062 | 3300042876 | Bacteria | 267945 |
| 110 | Ga0451577_0000420 | 3300042876 | Bacteria | 76673 |
| 111 | Ga0451577_0000632 | 3300042876 | Bacteria | 56385 |
| 112 | Ga0451577_0019427 | 3300042876 | Bacteria | 6249 |
| 113 | Ga0451577_0020389 | 3300042876 | Bacteria | 6085 |
| 114 | Ga0451577_0059313 | 3300042876 | Bacteria | 3412 |
| 115 | Ga0451577_0097300 | 3300042876 | Bacteria | 2628 |
| 116 | Ga0451577_0103197 | 3300042876 | Bacteria | 2548 |
| 117 | Ga0451577_0183308 | 3300042876 | Bacteria | 1888 |
| 118 | Ga0451577_0188342 | 3300042876 | Unclassified | 1861 |
| 119 | Ga0451577_0203543 | 3300042876 | Bacteria | 1787 |
| 120 | Ga0451577_0345731 | 3300042876 | Bacteria | 1349 |
| 121 | Ga0451577_0656312 | 3300042876 | Unclassified | 951 |
| 122 | Ga0451577_0843773 | 3300042876 | Bacteria | 826 |
| 123 | Ga0451577_2036638 | 3300042876 | Unclassified | 501 |
| 124 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 125 | Ga0453683_0000027 | 3300044673 | Bacteria | 248505 |
| 126 | Ga0453683_0000054 | 3300044673 | Bacteria | 194357 |
| 127 | Ga0453683_0000203 | 3300044673 | Bacteria | 80631 |
| 128 | Ga0453683_0000262 | 3300044673 | Bacteria | 69305 |
| 129 | Ga0453683_0000475 | 3300044673 | Bacteria | 46138 |
| 130 | Ga0453683_0002173 | 3300044673 | Bacteria | 15594 |
| 131 | Ga0453683_0006130 | 3300044673 | Bacteria | 8285 |
| 132 | Ga0453683_0010268 | 3300044673 | Bacteria | 6209 |
| 133 | Ga0453683_0011564 | 3300044673 | Bacteria | 5814 |
| 134 | Ga0453683_0131608 | 3300044673 | Bacteria | 1577 |
| 135 | Ga0453683_0524861 | 3300044673 | Bacteria | 769 |
| 136 | Ga0453683_0597984 | 3300044673 | Bacteria | 719 |
| 137 | Ga0453683_0964792 | 3300044673 | Bacteria | 565 |
| 138 | Ga0453684_0000022 | 3300044712 | Bacteria | 860785 |
| 139 | Ga0453684_0000442 | 3300044712 | Bacteria | 168993 |
| 140 | Ga0453684_0001253 | 3300044712 | Bacteria | 76698 |
| 141 | Ga0453684_0001677 | 3300044712 | Bacteria | 59940 |
| 142 | Ga0453684_0003070 | 3300044712 | Bacteria | 38652 |
| 143 | Ga0453684_0008941 | 3300044712 | Bacteria | 17720 |
| 144 | Ga0453684_0009732 | 3300044712 | Bacteria | 16699 |
| 145 | Ga0453684_0018320 | 3300044712 | Bacteria | 10761 |
| 146 | Ga0453684_0018684 | 3300044712 | Bacteria | 10622 |
| 147 | Ga0453684_0025207 | 3300044712 | Bacteria | 8645 |
| 148 | Ga0453684_0033667 | 3300044712 | Bacteria | 7136 |
| 149 | Ga0453684_0052278 | 3300044712 | Bacteria | 5344 |
| 150 | Ga0453684_0070956 | 3300044712 | Bacteria | 4407 |
| 151 | Ga0453684_0073659 | 3300044712 | Bacteria | 4304 |
| 152 | Ga0453684_0100441 | 3300044712 | Bacteria | 3541 |
| 153 | Ga0453684_0137113 | 3300044712 | Bacteria | 2927 |
| 154 | Ga0453684_0256168 | 3300044712 | Bacteria | 2007 |
| 155 | Ga0453684_0345227 | 3300044712 | Bacteria | 1680 |
| 156 | Ga0453684_0375041 | 3300044712 | Bacteria | 1598 |
| 157 | Ga0453684_0404018 | 3300044712 | Bacteria | 1529 |
| 158 | Ga0453684_0452703 | 3300044712 | Bacteria | 1428 |
| 159 | Ga0453684_0459099 | 3300044712 | Unclassified | 1417 |
| 160 | Ga0453684_0579202 | 3300044712 | Unclassified | 1233 |
| 161 | Ga0453684_1184160 | 3300044712 | Bacteria | 803 |
| 162 | Ga0453684_1418563 | 3300044712 | Bacteria | 719 |
| 163 | Ga0451576_0000026 | 3300045051 | Bacteria | 427585 |
| 164 | Ga0451576_0002575 | 3300045051 | Bacteria | 26691 |
| 165 | Ga0451576_0006476 | 3300045051 | Bacteria | 14345 |
| 166 | Ga0451576_0007089 | 3300045051 | Bacteria | 13540 |
| 167 | Ga0451576_0017423 | 3300045051 | Bacteria | 7899 |
| 168 | Ga0451576_0053791 | 3300045051 | Bacteria | 4216 |
| 169 | Ga0451576_0077324 | 3300045051 | Bacteria | 3463 |
| 170 | Ga0451576_0231541 | 3300045051 | Bacteria | 1930 |
| 171 | Ga0451576_0245835 | 3300045051 | Bacteria | 1869 |
| 172 | Ga0451576_0413381 | 3300045051 | Bacteria | 1415 |
| 173 | Ga0451576_0429019 | 3300045051 | Bacteria | 1387 |
| 174 | Ga0451576_0790797 | 3300045051 | Bacteria | 996 |
| 175 | Ga0451576_1170965 | 3300045051 | Bacteria | 803 |
| 176 | Ga0451576_1490929 | 3300045051 | Bacteria | 703 |
| 177 | Ga0451576_1969982 | 3300045051 | Bacteria | 602 |
| 178 | Ga0501080_1174166 | 3300049742 | Bacteria | 661 |
| 179 | Ga0501081_0597924 | 3300049743 | Bacteria | 826 |
| 180 | nmdc:mga0qj67_1211710_c1 | 3300050509 | Bacteria | 587 |
| 181 | Ga0495619_0911580 | 3300053085 | Bacteria | 591 |
| 182 | Ga0501082_1876038 | 3300060353 | Bacteria | 523 |
| 183 | Ga0453684_0017469 | |||
| 184 | Ga0065707_10183482 | |||
| 185 | Ga0070708_100021743 | |||
| 186 | Ga0114129_10890223 | |||
| 187 | Ga0114129_11891595 | |||
| 188 | Ga0265318_10019755 | |||
| 189 | Ga0265323_10142088 | |||
| 190 | Ga0265322_10087369 | |||
| 191 | Ga0265330_10132113 | |||
| 192 | Ga0265316_10001165 | |||
| 193 | Ga0265316_10004400 | |||
| 194 | Ga0265316_10030548 | |||
| 195 | Ga0307509_10555257 | |||
| 196 | Ga0307408_100305319 | |||
| 197 | Ga0316575_10001685 | |||
| 198 | Ga0316575_10001800 | |||
| 199 | Ga0316575_10045163 | |||
| 200 | Ga0316575_10319645 | |||
| 201 | Ga0316579_10004141 | |||
| 202 | Ga0316579_10007275 | |||
| 203 | Ga0316579_10016741 | |||
| 204 | Ga0316579_10016785 | |||
| 205 | Ga0316579_10019138 | |||
| 206 | Ga0316579_10041684 | |||
| 207 | Ga0316579_10051607 | |||
| 208 | Ga0316579_10098138 | |||
| 209 | Ga0316579_10308985 | |||
| 210 | Ga0265342_10024821 | |||
| 211 | Ga0265342_10137426 | |||
| 212 | Ga0316576_10064568 | |||
| 213 | Ga0316576_10084913 | |||
| 214 | Ga0316576_10173218 | |||
| 215 | Ga0316576_10178392 | |||
| 216 | Ga0316576_10364629 | |||
| 217 | Ga0316576_10416217 | |||
| 218 | Ga0316576_10761251 | |||
| 219 | Ga0316578_10001132 | |||
| 220 | Ga0316578_10057778 | |||
| 221 | Ga0316578_10245003 | |||
| 222 | Ga0316578_10247388 | |||
| 223 | Ga0316578_10276785 | |||
| 224 | Ga0316577_10000148 | |||
| 225 | Ga0316577_10000200 | |||
| 226 | Ga0316577_10000373 | |||
| 227 | Ga0316577_10000703 | |||
| 228 | Ga0316577_10001744 | |||
| 229 | Ga0316577_10002009 | |||
| 230 | Ga0316577_10011480 | |||
| 231 | Ga0316577_10013587 | |||
| 232 | Ga0316577_10070313 | |||
| 233 | Ga0316577_10097745 | |||
| 234 | Ga0316577_10443218 | |||
| 235 | Ga0316577_10461715 | |||
| 236 | Ga0307416_100635072 | |||
| 237 | Ga0316585_10055990 | |||
| 238 | Ga0316585_10091173 | |||
| 239 | Ga0316580_10158679 | |||
| 240 | Ga0316593_10114063 | |||
| 241 | Ga0316593_10141225 | |||
| 242 | Ga0316593_10155844 | |||
| 243 | Ga0316593_10253275 | |||
| 244 | Ga0316593_10330713 | |||
| 245 | Ga0316588_1200347 | |||
| 246 | Ga0316596_1125746 | |||
| 247 | Ga0316596_1173418 | |||
| 248 | Ga0373932_0014399 | |||
| 249 | Ga0316574_0006256 | |||
| 250 | Ga0316574_0156071 | |||
| 251 | Ga0316574_0384280 | |||
| 252 | Ga0316582_0000027 | |||
| 253 | Ga0316582_0000285 | |||
| 254 | Ga0316582_0001257 | |||
| 255 | Ga0316582_0002568 | |||
| 256 | Ga0316582_0004448 | |||
| 257 | Ga0316582_0024452 | |||
| 258 | Ga0316582_0026479 | |||
| 259 | Ga0316582_0038929 | |||
| 260 | Ga0316582_0039018 | |||
| 261 | Ga0316582_0088392 | |||
| 262 | Ga0316582_0291208 | |||
| 263 | Ga0316582_0303156 | |||
| 264 | Ga0316582_0343668 | |||
| 265 | Ga0316582_0437492 | |||
| 266 | Ga0316582_0538967 | |||
| 267 | Ga0316582_0549854 | |||
| 268 | Ga0316582_0917946 | |||
| 269 | Ga0316584_0000049 | |||
| 270 | Ga0316584_0000400 | |||
| 271 | Ga0316584_0004818 | |||
| 272 | Ga0316584_0023013 | |||
| 273 | Ga0316584_0030454 | |||
| 274 | Ga0316584_0039825 | |||
| 275 | Ga0316584_0041717 | |||
| 276 | Ga0316584_0096969 | |||
| 277 | Ga0316584_0115278 | |||
| 278 | Ga0316584_0191615 | |||
| 279 | Ga0316584_0349829 | |||
| 280 | Ga0316584_0478432 | |||
| 281 | Ga0316584_0498279 | |||
| 282 | Ga0316581_0000083 | |||
| 283 | Ga0316581_0002515 | |||
| 284 | Ga0316581_0003690 | |||
| 285 | Ga0316581_0005886 | |||
| 286 | Ga0316581_0007851 | |||
| 287 | Ga0316581_0012666 | |||
| 288 | Ga0316581_0015755 | |||
| 289 | Ga0316581_0039343 | |||
| 290 | Ga0316581_0145410 | |||
| 291 | Ga0451577_0000062 | |||
| 292 | Ga0451577_0000420 | |||
| 293 | Ga0451577_0000632 | |||
| 294 | Ga0451577_0019427 | |||
| 295 | Ga0451577_0020389 | |||
| 296 | Ga0451577_0059313 | |||
| 297 | Ga0451577_0097300 | |||
| 298 | Ga0451577_0103197 | |||
| 299 | Ga0451577_0183308 | |||
| 300 | Ga0451577_0188342 | |||
| 301 | Ga0451577_0203543 | |||
| 302 | Ga0451577_0345731 | |||
| 303 | Ga0451577_0656312 | |||
| 304 | Ga0451577_0843773 | |||
| 305 | Ga0451577_2036638 | |||
| 306 | Ga0453683_0000002 | |||
| 307 | Ga0453683_0000027 | |||
| 308 | Ga0453683_0000054 | |||
| 309 | Ga0453683_0000203 | |||
| 310 | Ga0453683_0000262 | |||
| 311 | Ga0453683_0000475 | |||
| 312 | Ga0453683_0002173 | |||
| 313 | Ga0453683_0006130 | |||
| 314 | Ga0453683_0010268 | |||
| 315 | Ga0453683_0011564 | |||
| 316 | Ga0453683_0131608 | |||
| 317 | Ga0453683_0524861 | |||
| 318 | Ga0453683_0597984 | |||
| 319 | Ga0453683_0964792 | |||
| 320 | Ga0453684_0000022 | |||
| 321 | Ga0453684_0000442 | |||
| 322 | Ga0453684_0001253 | |||
| 323 | Ga0453684_0001677 | |||
| 324 | Ga0453684_0003070 | |||
| 325 | Ga0453684_0008941 | |||
| 326 | Ga0453684_0009732 | |||
| 327 | Ga0453684_0018320 | |||
| 328 | Ga0453684_0018684 | |||
| 329 | Ga0453684_0025207 | |||
| 330 | Ga0453684_0033667 | |||
| 331 | Ga0453684_0052278 | |||
| 332 | Ga0453684_0070956 | |||
| 333 | Ga0453684_0073659 | |||
| 334 | Ga0453684_0100441 | |||
| 335 | Ga0453684_0137113 | |||
| 336 | Ga0453684_0256168 | |||
| 337 | Ga0453684_0345227 | |||
| 338 | Ga0453684_0375041 | |||
| 339 | Ga0453684_0404018 | |||
| 340 | Ga0453684_0452703 | |||
| 341 | Ga0453684_0459099 | |||
| 342 | Ga0453684_0579202 | |||
| 343 | Ga0453684_1184160 | |||
| 344 | Ga0453684_1418563 | |||
| 345 | Ga0451576_0000026 | |||
| 346 | Ga0451576_0002575 | |||
| 347 | Ga0451576_0006476 | |||
| 348 | Ga0451576_0007089 | |||
| 349 | Ga0451576_0017423 | |||
| 350 | Ga0451576_0053791 | |||
| 351 | Ga0451576_0077324 | |||
| 352 | Ga0451576_0231541 | |||
| 353 | Ga0451576_0245835 | |||
| 354 | Ga0451576_0413381 | |||
| 355 | Ga0451576_0429019 | |||
| 356 | Ga0451576_0790797 | |||
| 357 | Ga0451576_1170965 | |||
| 358 | Ga0451576_1490929 | |||
| 359 | Ga0451576_1969982 | |||
| 360 | Ga0501080_1174166 | |||
| 361 | Ga0501081_0597924 | |||
| 362 | nmdc:mga0qj67_1211710_c1 | |||
| 363 | Ga0495619_0911580 | |||
| 364 | Ga0501082_1876038 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4toc-assembly1.cif.gz_C | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9957 | 2 | 155 |
| 4toc-assembly1.cif.gz_A | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9957 | 4 | 155 |
| 4toc-assembly1.cif.gz_L | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9955 | 2 | 155 |
| 4toc-assembly1.cif.gz_B | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9955 | 2 | 155 |
| 4toc-assembly1.cif.gz_N | 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa | 0.9953 | 1 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5d8rA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9942 | 1 | 155 | 1.20.1260.10 |
| af_P0ABD3_1_158_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9936 | 1 | 155 | 1.20.1260.10 |
| 3iseA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9933 | 3 | 155 | 1.20.1260.10 |
| 2vxiG00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9932 | 1 | 155 | 1.20.1260.10 |
| 5xx9B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9932 | 1 | 155 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3WBW4-F1-model_v4 | Bacterioferritin | 1.003 | 1 | 131 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A3M1EPG4-F1-model_v4 | Bacterioferritin | 1.002 | 1 | 97 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A2V9SKB7-F1-model_v4 | Bacterioferritin | 1.002 | 1 | 108 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A2N7Q7Z3-F1-model_v4 | Bacterioferritin (EC 1.16.3.1) | 1.001 | 1 | 155 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A7Y2JDK9-F1-model_v4 | Bacterioferritin | 1.001 | 1 | 122 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |