F278939

General Info

Members Datasets Scaffolds Average Seq Length
182 131 364 264

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100654856|Ga0075428_1006548561
Length 288
Sequence VADDLAGKVAVITGGAAGIGRATAELFVAEGAKVVIADVDEERGGELAETLGNTARFKATDVSQRDQLQALVDFAVAEFGGLNIMFNNAGIGGSHHKRFIDDELQDFDRIMNINLLGVMVGTQYAARHMAKHGGGSIINTASIAGSVAGYGVVTYRASKAAVIHFSKSVSIDLAEHNIRVNCLTPGHIPTELNSFAVSGTEADKLAKITEALRPVWAASRPLKRIGSPADVAQAALYLASDRSQYVTGIVMPIDGGVSTGDAVNHLKALMDTRAKAIEEFEAEIAARA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
127 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
131 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 2.2
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100654856 3300006844 Bacteria 1120
2 JGI25407J50210_10012660 3300003373 Bacteria 2162
3 Ga0070676_10041522 3300005328 Bacteria 2668
4 Ga0070670_100499102 3300005331 Bacteria 1082
5 Ga0070668_100000415 3300005347 Bacteria 28362
6 Ga0070714_100049207 3300005435 Bacteria 3588
7 Ga0070714_100963207 3300005435 Bacteria 830
8 Ga0070713_100357823 3300005436 Bacteria 1356
9 Ga0070713_100433869 3300005436 Bacteria 1231
10 Ga0070708_100004316 3300005445 Bacteria 11173
11 Ga0070708_100014551 3300005445 Bacteria 6480
12 Ga0070708_100101286 3300005445 Bacteria 2637
13 Ga0070678_100173193 3300005456 Bacteria 1760
14 Ga0070681_10123763 3300005458 Bacteria 2519
15 Ga0070706_100073890 3300005467 Bacteria 3156
16 Ga0070698_100065430 3300005471 Bacteria 3660
17 Ga0070699_100026023 3300005518 Bacteria 5046
18 Ga0070693_100097194 3300005547 Bacteria 1787
19 Ga0070704_100382688 3300005549 Unclassified 1196
20 Ga0070702_100009703 3300005615 Bacteria 4721
21 Ga0070702_100245385 3300005615 Bacteria 1211
22 Ga0068862_100474446 3300005844 Bacteria 1183
23 Ga0081538_10001962 3300005981 Bacteria 20598
24 Ga0081538_10013634 3300005981 Bacteria 6428
25 Ga0081538_10087977 3300005981 Bacteria 1619
26 Ga0081539_10006793 3300005985 Bacteria 10734
27 Ga0070717_10345000 3300006028 Unclassified 1330
28 Ga0075365_10011103 3300006038 Bacteria 5284
29 Ga0075365_10014455 3300006038 Bacteria 4750
30 Ga0075365_10044446 3300006038 Bacteria 2910
31 Ga0075363_100007609 3300006048 Bacteria 4991
32 Ga0075364_10008149 3300006051 Bacteria 6252
33 Ga0075364_10061882 3300006051 Bacteria 2456
34 Ga0075428_100019981 3300006844 Bacteria 7417
35 Ga0075428_100140353 3300006844 Bacteria 2627
36 Ga0075428_100150849 3300006844 Bacteria 2525
37 Ga0075430_100090520 3300006846 Bacteria 2559
38 Ga0075430_100123880 3300006846 Bacteria 2155
39 Ga0075430_100280426 3300006846 Bacteria 1379
40 Ga0075431_100170779 3300006847 Bacteria 2234
41 Ga0075431_100351562 3300006847 Bacteria 1481
42 Ga0075431_100367705 3300006847 Bacteria 1444
43 Ga0075434_100006542 3300006871 Bacteria 10689
44 Ga0075436_100046891 3300006914 Bacteria 2980
45 Ga0075435_100000716 3300007076 Bacteria 20586
46 Ga0111539_10312729 3300009094 Bacteria 1828
47 Ga0111539_10418151 3300009094 Unclassified 1561
48 Ga0114129_10103004 3300009147 Bacteria 3947
49 Ga0105243_10082709 3300009148 Bacteria 2625
50 Ga0105243_10209839 3300009148 Bacteria 1714
51 Ga0105248_10063348 3300009177 Bacteria 4151
52 Ga0105246_10153461 3300011119 Bacteria 1746
53 Ga0163162_10150068 3300013306 Bacteria 2448
54 Ga0157379_10191234 3300014968 Bacteria 1850
55 Ga0213873_10002129 3300021358 Bacteria 3391
56 Ga0207645_10144579 3300025907 Bacteria 1550
57 Ga0207684_10100896 3300025910 Bacteria 2467
58 Ga0207662_10248770 3300025918 Bacteria 1166
59 Ga0207659_10201561 3300025926 Bacteria 1590
60 Ga0207700_10222571 3300025928 Unclassified 1601
61 Ga0207700_10360695 3300025928 Bacteria 1267
62 Ga0207711_10504529 3300025941 Bacteria 1128
63 Ga0207712_10386839 3300025961 Bacteria 1172
64 Ga0207712_10541399 3300025961 Bacteria 1000
65 Ga0207668_10000815 3300025972 Bacteria 19101
66 Ga0207668_10352739 3300025972 Bacteria 1231
67 Ga0207703_10500316 3300026035 Bacteria 1141
68 Ga0207708_10230140 3300026075 Bacteria 1488
69 Ga0207648_10101446 3300026089 Bacteria 2522
70 Ga0207675_100085276 3300026118 Bacteria 2964
71 Ga0207683_10083656 3300026121 Bacteria 2836
72 Ga0207683_10568717 3300026121 Bacteria 1048
73 Ga0268265_10112272 3300028380 Bacteria 2228
74 Ga0268265_10267673 3300028380 Bacteria 1523
75 Ga0265337_1000344 3300028556 Bacteria 24844
76 Ga0265326_10001175 3300028558 Bacteria 9348
77 Ga0265319_1001002 3300028563 Bacteria 17683
78 Ga0265334_10000352 3300028573 Bacteria 24678
79 Ga0265318_10013016 3300028577 Bacteria 3526
80 Ga0265323_10009447 3300028653 Bacteria 3984
81 Ga0265322_10013682 3300028654 Bacteria 2349
82 Ga0265336_10004172 3300028666 Bacteria 5502
83 Ga0265338_10001934 3300028800 Bacteria 32315
84 Ga0265338_10002405 3300028800 Bacteria 28155
85 Ga0265324_10003401 3300029957 Bacteria 7601
86 Ga0307511_10009553 3300030521 Bacteria 9660
87 Ga0307512_10022479 3300030522 Bacteria 5665
88 Ga0265332_10000856 3300031238 Bacteria 18431
89 Ga0265320_10004318 3300031240 Bacteria 9339
90 Ga0265340_10003361 3300031247 Bacteria 9050
91 Ga0265316_10008416 3300031344 Bacteria 9579
92 Ga0307509_10000142 3300031507 Bacteria 108077
93 Ga0307509_10006218 3300031507 Bacteria 16155
94 Ga0265313_10004006 3300031595 Bacteria 11530
95 Ga0307508_10175384 3300031616 Bacteria 1747
96 Ga0265314_10022146 3300031711 Bacteria 4871
97 Ga0265342_10001468 3300031712 Bacteria 21929
98 Ga0316576_10056178 3300031727 Unclassified 2874
99 Ga0316576_10173121 3300031727 Bacteria 1629
100 Ga0316578_10044859 3300031728 Unclassified 2573
101 Ga0307516_10008354 3300031730 Bacteria 11731
102 Ga0307518_10052305 3300031838 Bacteria 2967
103 Ga0307406_10436876 3300031901 Bacteria 1047
104 Ga0307510_10004307 3300033180 Bacteria 16748
105 Ga0307510_10013857 3300033180 Bacteria 9554
106 Ga0316574_0032937 3300035398 Bacteria 3153
107 Ga0316574_0036410 3300035398 Plasmid 3013
108 Ga0316574_0040623 3300035398 Bacteria 2865
109 Ga0316584_0089051 3300036712 Bacteria 2311
110 Ga0316584_0120106 3300036712 Bacteria 1964
111 Ga0373925_0000053 3300037068 Bacteria 125353
112 Ga0436364_0702942 3300037853 Bacteria 1003
113 Ga0400483_034183 3300039062 Bacteria 2029
114 Ga0436362_0834641 3300039453 Bacteria 1908
115 Ga0439465_0074566 3300041413 Bacteria 1142
116 Ga0439463_016000 3300042016 Bacteria 1855
117 Ga0439460_0001771 3300042461 Bacteria 5129
118 Ga0495629_0120328 3300046459 Bacteria 1829
119 Ga0495582_0264352 3300046473 Bacteria 987
120 Ga0495639_0117920 3300046475 Bacteria 1264
121 Ga0495608_0246803 3300046511 Bacteria 1114
122 Ga0495618_0028466 3300046514 Bacteria 3482
123 Ga0495630_0045551 3300046517 Bacteria 3278
124 Ga0495625_0003020 3300046660 Bacteria 17291
125 Ga0495613_0000422 3300046689 Bacteria 36383
126 Ga0495613_0152236 3300046689 Bacteria 1649
127 Ga0495674_0480444 3300047319 Bacteria 996
128 Ga0495680_0104742 3300047322 Bacteria 2104
129 Ga0495687_001424 3300047443 Bacteria 22030
130 Ga0496101_0178900 3300048904 Bacteria 1633
131 Ga0496102_0474508 3300048905 Bacteria 1172
132 Ga0496110_0506097 3300048913 Bacteria 1099
133 Ga0496114_0419166 3300048917 Bacteria 1186
134 Ga0501034_0000034 3300049571 Bacteria 242608
135 Ga0501037_0051305 3300049573 Bacteria 3017
136 Ga0501040_0219061 3300049576 Bacteria 1354
137 Ga0501046_0138236 3300049580 Bacteria 1845
138 Ga0501068_0000762 3300049584 Bacteria 16559
139 Ga0501068_0011202 3300049584 Bacteria 5055
140 Ga0501068_0019193 3300049584 Bacteria 3967
141 Ga0501068_0101101 3300049584 Bacteria 1787
142 Ga0501069_0002326 3300049585 Bacteria 9601
143 Ga0501070_0000942 3300049586 Bacteria 26254
144 Ga0501070_0021917 3300049586 Bacteria 5353
145 Ga0501070_0024098 3300049586 Bacteria 5103
146 Ga0501070_0200508 3300049586 Bacteria 1639
147 Ga0501072_0002284 3300049588 Bacteria 14335
148 Ga0501072_0114892 3300049588 Bacteria 2143
149 Ga0501073_0000289 3300049589 Bacteria 33122
150 Ga0501073_0002770 3300049589 Bacteria 13128
151 Ga0501073_0110492 3300049589 Bacteria 1907
152 Ga0501074_0000229 3300049590 Bacteria 31188
153 Ga0501077_0044388 3300049593 Bacteria 2824
154 Ga0501079_0004950 3300049741 Bacteria 9877
155 Ga0501079_0135106 3300049741 Bacteria 1920
156 Ga0501080_0010103 3300049742 Bacteria 8631
157 Ga0501080_0010575 3300049742 Bacteria 8447
158 Ga0501083_0000608 3300049744 Bacteria 23082
159 Ga0501083_0028292 3300049744 Bacteria 3864
160 nmdc:mga03n38_11595_c1 3300050490 Bacteria 3290
161 nmdc:mga03n38_461964_c1 3300050490 Bacteria 708
162 nmdc:mga00v17_21745_c1 3300050491 Bacteria 3692
163 nmdc:mga0yw44_269961_c1 3300050492 Bacteria 1135
164 nmdc:mga0yw44_5786_c1 3300050492 Bacteria 5892
165 nmdc:mga05p37_216752_c1 3300050507 Bacteria 2312
166 nmdc:mga05p37_614137_c1 3300050507 Bacteria 1225
167 nmdc:mga09592_162177_c1 3300050508 Bacteria 1932
168 nmdc:mga0qj67_425275_c1 3300050509 Bacteria 1071
169 nmdc:mga0qj67_57956_c1 3300050509 Bacteria 3071
170 nmdc:mga06r32_70213_c1 3300050510 Bacteria 3387
171 nmdc:mga06r32_89548_c1 3300050510 Bacteria 3005
172 nmdc:mga08y16_31758_c1 3300050511 Bacteria 5552
173 nmdc:mga08x19_4160_c1 3300050514 Bacteria 8577
174 nmdc:mga0a205_20340_c1 3300050515 Bacteria 6261
175 Ga0500658_0075760 3300053134 Bacteria 1429
176 Ga0500637_0034576 3300053178 Bacteria 2828
177 Ga0501084_0003600 3300054114 Bacteria 12584
178 Ga0501084_0135748 3300054114 Bacteria 2071
179 Ga0501084_0299574 3300054114 Bacteria 1358
180 Ga0530510_0027718 3300061734 Bacteria 4059
181 2840880265 2840878972 Bacteria 5483153
182 2902800118 2902799365 Bacteria 5419524
183 Ga0075428_100654856
184 JGI25407J50210_10012660
185 Ga0070676_10041522
186 Ga0070670_100499102
187 Ga0070668_100000415
188 Ga0070714_100049207
189 Ga0070714_100963207
190 Ga0070713_100357823
191 Ga0070713_100433869
192 Ga0070708_100004316
193 Ga0070708_100014551
194 Ga0070708_100101286
195 Ga0070678_100173193
196 Ga0070681_10123763
197 Ga0070706_100073890
198 Ga0070698_100065430
199 Ga0070699_100026023
200 Ga0070693_100097194
201 Ga0070704_100382688
202 Ga0070702_100009703
203 Ga0070702_100245385
204 Ga0068862_100474446
205 Ga0081538_10001962
206 Ga0081538_10013634
207 Ga0081538_10087977
208 Ga0081539_10006793
209 Ga0070717_10345000
210 Ga0075365_10011103
211 Ga0075365_10014455
212 Ga0075365_10044446
213 Ga0075363_100007609
214 Ga0075364_10008149
215 Ga0075364_10061882
216 Ga0075428_100019981
217 Ga0075428_100140353
218 Ga0075428_100150849
219 Ga0075430_100090520
220 Ga0075430_100123880
221 Ga0075430_100280426
222 Ga0075431_100170779
223 Ga0075431_100351562
224 Ga0075431_100367705
225 Ga0075434_100006542
226 Ga0075436_100046891
227 Ga0075435_100000716
228 Ga0111539_10312729
229 Ga0111539_10418151
230 Ga0114129_10103004
231 Ga0105243_10082709
232 Ga0105243_10209839
233 Ga0105248_10063348
234 Ga0105246_10153461
235 Ga0163162_10150068
236 Ga0157379_10191234
237 Ga0213873_10002129
238 Ga0207645_10144579
239 Ga0207684_10100896
240 Ga0207662_10248770
241 Ga0207659_10201561
242 Ga0207700_10222571
243 Ga0207700_10360695
244 Ga0207711_10504529
245 Ga0207712_10386839
246 Ga0207712_10541399
247 Ga0207668_10000815
248 Ga0207668_10352739
249 Ga0207703_10500316
250 Ga0207708_10230140
251 Ga0207648_10101446
252 Ga0207675_100085276
253 Ga0207683_10083656
254 Ga0207683_10568717
255 Ga0268265_10112272
256 Ga0268265_10267673
257 Ga0265337_1000344
258 Ga0265326_10001175
259 Ga0265319_1001002
260 Ga0265334_10000352
261 Ga0265318_10013016
262 Ga0265323_10009447
263 Ga0265322_10013682
264 Ga0265336_10004172
265 Ga0265338_10001934
266 Ga0265338_10002405
267 Ga0265324_10003401
268 Ga0307511_10009553
269 Ga0307512_10022479
270 Ga0265332_10000856
271 Ga0265320_10004318
272 Ga0265340_10003361
273 Ga0265316_10008416
274 Ga0307509_10000142
275 Ga0307509_10006218
276 Ga0265313_10004006
277 Ga0307508_10175384
278 Ga0265314_10022146
279 Ga0265342_10001468
280 Ga0316576_10056178
281 Ga0316576_10173121
282 Ga0316578_10044859
283 Ga0307516_10008354
284 Ga0307518_10052305
285 Ga0307406_10436876
286 Ga0307510_10004307
287 Ga0307510_10013857
288 Ga0316574_0032937
289 Ga0316574_0036410
290 Ga0316574_0040623
291 Ga0316584_0089051
292 Ga0316584_0120106
293 Ga0373925_0000053
294 Ga0436364_0702942
295 Ga0400483_034183
296 Ga0436362_0834641
297 Ga0439465_0074566
298 Ga0439463_016000
299 Ga0439460_0001771
300 Ga0495629_0120328
301 Ga0495582_0264352
302 Ga0495639_0117920
303 Ga0495608_0246803
304 Ga0495618_0028466
305 Ga0495630_0045551
306 Ga0495625_0003020
307 Ga0495613_0000422
308 Ga0495613_0152236
309 Ga0495674_0480444
310 Ga0495680_0104742
311 Ga0495687_001424
312 Ga0496101_0178900
313 Ga0496102_0474508
314 Ga0496110_0506097
315 Ga0496114_0419166
316 Ga0501034_0000034
317 Ga0501037_0051305
318 Ga0501040_0219061
319 Ga0501046_0138236
320 Ga0501068_0000762
321 Ga0501068_0011202
322 Ga0501068_0019193
323 Ga0501068_0101101
324 Ga0501069_0002326
325 Ga0501070_0000942
326 Ga0501070_0021917
327 Ga0501070_0024098
328 Ga0501070_0200508
329 Ga0501072_0002284
330 Ga0501072_0114892
331 Ga0501073_0000289
332 Ga0501073_0002770
333 Ga0501073_0110492
334 Ga0501074_0000229
335 Ga0501077_0044388
336 Ga0501079_0004950
337 Ga0501079_0135106
338 Ga0501080_0010103
339 Ga0501080_0010575
340 Ga0501083_0000608
341 Ga0501083_0028292
342 nmdc:mga03n38_11595_c1
343 nmdc:mga03n38_461964_c1
344 nmdc:mga00v17_21745_c1
345 nmdc:mga0yw44_269961_c1
346 nmdc:mga0yw44_5786_c1
347 nmdc:mga05p37_216752_c1
348 nmdc:mga05p37_614137_c1
349 nmdc:mga09592_162177_c1
350 nmdc:mga0qj67_425275_c1
351 nmdc:mga0qj67_57956_c1
352 nmdc:mga06r32_70213_c1
353 nmdc:mga06r32_89548_c1
354 nmdc:mga08y16_31758_c1
355 nmdc:mga08x19_4160_c1
356 nmdc:mga0a205_20340_c1
357 Ga0500658_0075760
358 Ga0500637_0034576
359 Ga0501084_0003600
360 Ga0501084_0135748
361 Ga0501084_0299574
362 Ga0530510_0027718
363 2840880265
364 2902800118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

200

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

14

258

0.9

PF08659

KR

KR domain

9

172

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9743 3 244
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9659 8 243
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9618 4 242
6b9u-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh 0.9604 5 242
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9603 3 242
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.974 2 95 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 2 168 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9633 2 183 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9628 3 244 3.40.50.720
af_A0A1D6EBW2_14_281_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9618 1 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7T4QYX8-F1-model_v4 SDR family oxidoreductase 0.9906 1 244 GO:0016491
AF-A0A135VLW5-F1-model_v4 Short-chain dehydrogenase 0.9819 5 191 GO:0016491
AF-A0A2W5ZT76-F1-model_v4 Cupin type-2 domain-containing protein 0.9802 4 191 GO:0016616
GO:0030497
AF-A0A2K1K6N4-F1-model_v4 Uncharacterized protein 0.9758 6 181
AF-A0A3S1JP73-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9748 4 191 GO:0047936

Map