F278892

General Info

Members Datasets Scaffolds Average Seq Length
182 121 364 351

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10006045|Ga0081539_100060455
Length 370
Sequence VIKVLVVDDSALMRKLLGRIFSKEADFEVQFARNGLEALDLLAAFKPDAVTLDIHMPQMDGLACLDRIMIERPCPVVMVSSLTAEGAEITLQALRLGAIDFVAKPAGAISLHIDELTEEILTKVRAASSARIRSSTRLKERVRHRIGRDAPPNRREEDRVEEGHLEHGRRRDRREPRRASGEGLVLVGTSTGGPPALEALLTALPGDFRWPIVVAQHMPATFTGALARRLNGVSALSVVEVVRTLPLEPRCVYIGKGDADLLIDRRPSGLVAAPVRSLADYPWHPSTDRLVRSAMDHLSPAQIVGVLMTGMGSDGAEALALLRARGGRTIAEAEETAVVWGMPGELVAAGGADWVLPLPQIAGWLTKLVP

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
90 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
114 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
115 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
116 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
120 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
121 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.53
Nodule 0.55
Rhizoplane 3.85
Rhizosphere 68.68
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10006045 3300005985 Bacteria 11859
2 rootH1_10362723 3300003323 Bacteria 3269
3 JGI25160J50197_1029139 3300003354 Bacteria 1467
4 Ga0055543_1015170 3300004625 Bacteria 1488
5 Ga0070690_100079911 3300005330 Bacteria 2138
6 Ga0070670_100025621 3300005331 Bacteria 5073
7 Ga0068869_100031200 3300005334 Bacteria 3748
8 Ga0068869_100064773 3300005334 Bacteria 2689
9 Ga0070680_100343442 3300005336 Unclassified 1269
10 Ga0070668_100000072 3300005347 Bacteria 62530
11 Ga0070675_100069940 3300005354 Bacteria 2908
12 Ga0070671_100009052 3300005355 Bacteria 7991
13 Ga0070671_100047220 3300005355 Bacteria 3581
14 Ga0070671_100048107 3300005355 Bacteria 3546
15 Ga0070671_100194202 3300005355 Bacteria 1721
16 Ga0070673_100387412 3300005364 Bacteria 1247
17 Ga0070714_100085973 3300005435 Bacteria 2748
18 Ga0070713_100122858 3300005436 Bacteria 2279
19 Ga0070710_10044092 3300005437 Bacteria 2473
20 Ga0070701_10093690 3300005438 Bacteria 1651
21 Ga0070700_100064537 3300005441 Bacteria 2319
22 Ga0070700_100156520 3300005441 Bacteria 1564
23 Ga0070694_100062189 3300005444 Bacteria 2550
24 Ga0070678_100023927 3300005456 Bacteria 4080
25 Ga0068867_100072491 3300005459 Bacteria 2578
26 Ga0068853_100011179 3300005539 Bacteria 7282
27 Ga0070672_100037515 3300005543 Unclassified 3698
28 Ga0070672_100141751 3300005543 Bacteria 1983
29 Ga0070695_100113461 3300005545 Bacteria 1843
30 Ga0070665_100019682 3300005548 Bacteria 6776
31 Ga0070665_100027524 3300005548 Bacteria 5727
32 Ga0070665_100393090 3300005548 Bacteria 1394
33 Ga0070664_100385482 3300005564 Bacteria 1280
34 Ga0068852_100000934 3300005616 Bacteria 19278
35 Ga0068859_100015458 3300005617 Bacteria 7667
36 Ga0068859_100162430 3300005617 Bacteria 2313
37 Ga0068861_100032740 3300005719 Bacteria 3830
38 Ga0068861_100165670 3300005719 Bacteria 1827
39 Ga0068851_10000709 3300005834 Bacteria 14217
40 Ga0068870_10073791 3300005840 Bacteria 1867
41 Ga0068863_100178454 3300005841 Bacteria 2039
42 Ga0068858_100005532 3300005842 Bacteria 12370
43 Ga0068858_100014550 3300005842 Bacteria 7413
44 Ga0068858_100061523 3300005842 Bacteria 3471
45 Ga0068862_100000644 3300005844 Bacteria 36054
46 Ga0068862_100065465 3300005844 Bacteria 3130
47 Ga0068862_100369305 3300005844 Bacteria 1335
48 Ga0075365_10010553 3300006038 Bacteria 5386
49 Ga0075365_10011691 3300006038 Bacteria 5174
50 Ga0075363_100106141 3300006048 Bacteria 1558
51 Ga0075364_10000473 3300006051 Bacteria 20448
52 Ga0075362_10012200 3300006177 Bacteria 3408
53 Ga0075367_10005030 3300006178 Bacteria 6517
54 Ga0075367_10006161 3300006178 Bacteria 6037
55 Ga0075367_10057827 3300006178 Bacteria 2306
56 Ga0075367_10115037 3300006178 Bacteria 1654
57 Ga0075369_10001357 3300006186 Bacteria 8319
58 Ga0075366_10000184 3300006195 Bacteria 27407
59 Ga0097621_100100519 3300006237 Bacteria 2433
60 Ga0068871_100145595 3300006358 Bacteria 2017
61 Ga0075428_100002041 3300006844 Bacteria 21770
62 Ga0075428_100008575 3300006844 Bacteria 11338
63 Ga0075430_100122865 3300006846 Bacteria 2165
64 Ga0075429_100044300 3300006880 Bacteria 3871
65 Ga0097620_100015458 3300006931 Bacteria 7667
66 Ga0097620_100162440 3300006931 Bacteria 2313
67 Ga0111539_10000589 3300009094 Bacteria 46837
68 Ga0111539_10007473 3300009094 Bacteria 13993
69 Ga0111539_10036822 3300009094 Bacteria 5912
70 Ga0111539_10309134 3300009094 Bacteria 1839
71 Ga0105245_10091808 3300009098 Bacteria 2795
72 Ga0105247_10055254 3300009101 Bacteria 2450
73 Ga0105248_10089534 3300009177 Bacteria 3464
74 Ga0105248_10250007 3300009177 Bacteria 1996
75 Ga0105237_10318575 3300009545 Unclassified 1558
76 Ga0105238_10036802 3300009551 Bacteria 4977
77 Ga0157374_10043302 3300013296 Bacteria 4158
78 Ga0157378_10017157 3300013297 Bacteria 6347
79 Ga0163162_10049149 3300013306 Bacteria 4227
80 Ga0163162_10254584 3300013306 Bacteria 1888
81 Ga0157375_10068723 3300013308 Bacteria 3546
82 Ga0157375_10507895 3300013308 Bacteria 1369
83 Ga0163163_10004217 3300014325 Bacteria 12254
84 Ga0163163_10110533 3300014325 Bacteria 2777
85 Ga0163163_10236878 3300014325 Bacteria 1874
86 Ga0157380_10061918 3300014326 Bacteria 2996
87 Ga0157380_10153182 3300014326 Bacteria 1995
88 Ga0157379_10084668 3300014968 Bacteria 2841
89 Ga0157376_10003473 3300014969 Bacteria 10863
90 Ga0157376_10010372 3300014969 Bacteria 6811
91 Ga0157376_10220907 3300014969 Bacteria 1755
92 Ga0157376_10357095 3300014969 Bacteria 1400
93 Ga0209130_1001109 3300025284 Bacteria 19835
94 Ga0207426_1001431 3300025302 Bacteria 19826
95 Ga0207426_1008170 3300025302 Bacteria 4264
96 Ga0207699_10169476 3300025906 Bacteria 1460
97 Ga0207660_10123054 3300025917 Bacteria 1967
98 Ga0207659_10222750 3300025926 Bacteria 1517
99 Ga0207644_10066766 3300025931 Bacteria 2620
100 Ga0207644_10176448 3300025931 Bacteria 1672
101 Ga0207686_10132195 3300025934 Bacteria 1713
102 Ga0207704_10050454 3300025938 Unclassified 2510
103 Ga0207668_10068163 3300025972 Bacteria 2528
104 Ga0207703_10003902 3300026035 Bacteria 12381
105 Ga0207703_10012901 3300026035 Bacteria 6514
106 Ga0207703_10017086 3300026035 Bacteria 5658
107 Ga0207639_10007935 3300026041 Bacteria 7253
108 Ga0207678_10030610 3300026067 Bacteria 4698
109 Ga0207708_10087769 3300026075 Bacteria 2395
110 Ga0207648_10043883 3300026089 Bacteria 3924
111 Ga0207648_10084544 3300026089 Bacteria 2768
112 Ga0207648_10144439 3300026089 Bacteria 2098
113 Ga0207676_10076849 3300026095 Bacteria 2699
114 Ga0207675_100015249 3300026118 Bacteria 7168
115 Ga0207698_10001230 3300026142 Bacteria 14974
116 Ga0209813_10003055 3300027866 Bacteria 3889
117 Ga0207428_10003161 3300027907 Bacteria 16135
118 Ga0207428_10005533 3300027907 Bacteria 11769
119 Ga0207428_10027160 3300027907 Bacteria 4767
120 Ga0268266_10033272 3300028379 Bacteria 4383
121 Ga0268266_10058197 3300028379 Bacteria 3327
122 Ga0268266_10227064 3300028379 Bacteria 1718
123 Ga0268266_10295190 3300028379 Bacteria 1510
124 Ga0268265_10001386 3300028380 Bacteria 20547
125 Ga0268265_10433805 3300028380 Bacteria 1223
126 Ga0265338_10015874 3300028800 Bacteria 8243
127 Ga0265327_10005268 3300031251 Bacteria 10888
128 Ga0307413_10166070 3300031824 Bacteria 1557
129 Ga0307410_10010613 3300031852 Bacteria 5228
130 Ga0307410_10039418 3300031852 Bacteria 3102
131 Ga0307409_100052653 3300031995 Bacteria 3123
132 Ga0307414_10015691 3300032004 Bacteria 4579
133 Ga0307415_100045370 3300032126 Bacteria 2946
134 Ga0373941_0019911 3300035115 Bacteria 1875
135 Ga0451847_0142134 3300041503 Bacteria 1148
136 Ga0496104_0038215 3300048907 Bacteria 4491
137 Ga0496104_0130956 3300048907 Bacteria 2409
138 Ga0496105_0111127 3300048908 Bacteria 2262
139 Ga0496108_0090713 3300048911 Bacteria 2598
140 Ga0496109_0098862 3300048912 Bacteria 2706
141 Ga0496110_0044088 3300048913 Bacteria 3895
142 Ga0496114_0030102 3300048917 Bacteria 4464
143 Ga0496118_0037478 3300048921 Bacteria 3901
144 Ga0496121_0001046 3300048924 Bacteria 49319
145 Ga0496122_0095712 3300048925 Bacteria 2005
146 Ga0496126_0005492 3300048929 Bacteria 14447
147 Ga0496126_0013498 3300048929 Bacteria 8300
148 Ga0496126_0199432 3300048929 Bacteria 1691
149 Ga0501043_0168046 3300049579 Bacteria 1712
150 Ga0501047_0033366 3300049581 Bacteria 4969
151 nmdc:mga03683_4510_c1 3300050489 Bacteria 1904
152 nmdc:mga03n38_16564_c1 3300050490 Bacteria 2869
153 nmdc:mga03n38_2894_c1 3300050490 Bacteria 5410
154 nmdc:mga03n38_48356_c1 3300050490 Bacteria 1886
155 nmdc:mga03n38_88653_c1 3300050490 Bacteria 1468
156 nmdc:mga00v17_1110_c1 3300050491 Bacteria 14150
157 nmdc:mga06z11_6940_c1 3300050494 Bacteria 4639
158 nmdc:mga06z11_71475_c1 3300050494 Bacteria 1837
159 nmdc:mga04h51_324_c1 3300050495 Bacteria 12022
160 nmdc:mga04h51_3348_c1 3300050495 Bacteria 3889
161 nmdc:mga07m45_12787_c1 3300050496 Bacteria 4440
162 nmdc:mga07m45_19736_c1 3300050496 Bacteria 3654
163 nmdc:mga09592_130838_c1 3300050508 Bacteria 2159
164 nmdc:mga08y16_2470_c1 3300050511 Bacteria 18989
165 nmdc:mga08y16_43077_c1 3300050511 Bacteria 4729
166 nmdc:mga08y16_514_c1 3300050511 Bacteria 35764
167 nmdc:mga0n895_13056_c1 3300050512 Bacteria 7472
168 nmdc:mga0rr50_117001_c1 3300050513 Bacteria 2116
169 nmdc:mga0rr50_6787_c1 3300050513 Bacteria 7012
170 nmdc:mga0sz30_538_c1 3300050516 Bacteria 14111
171 nmdc:mga0sz30_6130_c1 3300050516 Bacteria 4451
172 Ga0500643_004434 3300053087 Bacteria 6350
173 Ga0500641_0000967 3300053096 Bacteria 10219
174 Ga0500641_0002817 3300053096 Bacteria 6165
175 Ga0500572_000091 3300053111 Bacteria 29333
176 Ga0500595_000280 3300053119 Bacteria 33866
177 Ga0500568_0007406 3300053139 Bacteria 5385
178 Ga0500568_0012175 3300053139 Bacteria 3963
179 Ga0500568_0079237 3300053139 Bacteria 1249
180 Ga0500603_017493 3300053150 Bacteria 1714
181 Ga0500637_0085146 3300053178 Bacteria 1828
182 2528857175 2528768022 Bacteria 10457665
183 Ga0081539_10006045
184 rootH1_10362723
185 JGI25160J50197_1029139
186 Ga0055543_1015170
187 Ga0070690_100079911
188 Ga0070670_100025621
189 Ga0068869_100031200
190 Ga0068869_100064773
191 Ga0070680_100343442
192 Ga0070668_100000072
193 Ga0070675_100069940
194 Ga0070671_100009052
195 Ga0070671_100047220
196 Ga0070671_100048107
197 Ga0070671_100194202
198 Ga0070673_100387412
199 Ga0070714_100085973
200 Ga0070713_100122858
201 Ga0070710_10044092
202 Ga0070701_10093690
203 Ga0070700_100064537
204 Ga0070700_100156520
205 Ga0070694_100062189
206 Ga0070678_100023927
207 Ga0068867_100072491
208 Ga0068853_100011179
209 Ga0070672_100037515
210 Ga0070672_100141751
211 Ga0070695_100113461
212 Ga0070665_100019682
213 Ga0070665_100027524
214 Ga0070665_100393090
215 Ga0070664_100385482
216 Ga0068852_100000934
217 Ga0068859_100015458
218 Ga0068859_100162430
219 Ga0068861_100032740
220 Ga0068861_100165670
221 Ga0068851_10000709
222 Ga0068870_10073791
223 Ga0068863_100178454
224 Ga0068858_100005532
225 Ga0068858_100014550
226 Ga0068858_100061523
227 Ga0068862_100000644
228 Ga0068862_100065465
229 Ga0068862_100369305
230 Ga0075365_10010553
231 Ga0075365_10011691
232 Ga0075363_100106141
233 Ga0075364_10000473
234 Ga0075362_10012200
235 Ga0075367_10005030
236 Ga0075367_10006161
237 Ga0075367_10057827
238 Ga0075367_10115037
239 Ga0075369_10001357
240 Ga0075366_10000184
241 Ga0097621_100100519
242 Ga0068871_100145595
243 Ga0075428_100002041
244 Ga0075428_100008575
245 Ga0075430_100122865
246 Ga0075429_100044300
247 Ga0097620_100015458
248 Ga0097620_100162440
249 Ga0111539_10000589
250 Ga0111539_10007473
251 Ga0111539_10036822
252 Ga0111539_10309134
253 Ga0105245_10091808
254 Ga0105247_10055254
255 Ga0105248_10089534
256 Ga0105248_10250007
257 Ga0105237_10318575
258 Ga0105238_10036802
259 Ga0157374_10043302
260 Ga0157378_10017157
261 Ga0163162_10049149
262 Ga0163162_10254584
263 Ga0157375_10068723
264 Ga0157375_10507895
265 Ga0163163_10004217
266 Ga0163163_10110533
267 Ga0163163_10236878
268 Ga0157380_10061918
269 Ga0157380_10153182
270 Ga0157379_10084668
271 Ga0157376_10003473
272 Ga0157376_10010372
273 Ga0157376_10220907
274 Ga0157376_10357095
275 Ga0209130_1001109
276 Ga0207426_1001431
277 Ga0207426_1008170
278 Ga0207699_10169476
279 Ga0207660_10123054
280 Ga0207659_10222750
281 Ga0207644_10066766
282 Ga0207644_10176448
283 Ga0207686_10132195
284 Ga0207704_10050454
285 Ga0207668_10068163
286 Ga0207703_10003902
287 Ga0207703_10012901
288 Ga0207703_10017086
289 Ga0207639_10007935
290 Ga0207678_10030610
291 Ga0207708_10087769
292 Ga0207648_10043883
293 Ga0207648_10084544
294 Ga0207648_10144439
295 Ga0207676_10076849
296 Ga0207675_100015249
297 Ga0207698_10001230
298 Ga0209813_10003055
299 Ga0207428_10003161
300 Ga0207428_10005533
301 Ga0207428_10027160
302 Ga0268266_10033272
303 Ga0268266_10058197
304 Ga0268266_10227064
305 Ga0268266_10295190
306 Ga0268265_10001386
307 Ga0268265_10433805
308 Ga0265338_10015874
309 Ga0265327_10005268
310 Ga0307413_10166070
311 Ga0307410_10010613
312 Ga0307410_10039418
313 Ga0307409_100052653
314 Ga0307414_10015691
315 Ga0307415_100045370
316 Ga0373941_0019911
317 Ga0451847_0142134
318 Ga0496104_0038215
319 Ga0496104_0130956
320 Ga0496105_0111127
321 Ga0496108_0090713
322 Ga0496109_0098862
323 Ga0496110_0044088
324 Ga0496114_0030102
325 Ga0496118_0037478
326 Ga0496121_0001046
327 Ga0496122_0095712
328 Ga0496126_0005492
329 Ga0496126_0013498
330 Ga0496126_0199432
331 Ga0501043_0168046
332 Ga0501047_0033366
333 nmdc:mga03683_4510_c1
334 nmdc:mga03n38_16564_c1
335 nmdc:mga03n38_2894_c1
336 nmdc:mga03n38_48356_c1
337 nmdc:mga03n38_88653_c1
338 nmdc:mga00v17_1110_c1
339 nmdc:mga06z11_6940_c1
340 nmdc:mga06z11_71475_c1
341 nmdc:mga04h51_324_c1
342 nmdc:mga04h51_3348_c1
343 nmdc:mga07m45_12787_c1
344 nmdc:mga07m45_19736_c1
345 nmdc:mga09592_130838_c1
346 nmdc:mga08y16_2470_c1
347 nmdc:mga08y16_43077_c1
348 nmdc:mga08y16_514_c1
349 nmdc:mga0n895_13056_c1
350 nmdc:mga0rr50_117001_c1
351 nmdc:mga0rr50_6787_c1
352 nmdc:mga0sz30_538_c1
353 nmdc:mga0sz30_6130_c1
354 Ga0500643_004434
355 Ga0500641_0000967
356 Ga0500641_0002817
357 Ga0500572_000091
358 Ga0500595_000280
359 Ga0500568_0007406
360 Ga0500568_0012175
361 Ga0500568_0079237
362 Ga0500603_017493
363 Ga0500637_0085146
364 2528857175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

185

365

0.93

PF00072

Response_reg

Response regulator receiver domain

4

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9412 1 127
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.9391 171 356
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9347 170 359
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9299 170 359
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9256 1 127
ID Description Score Start End Superfamily
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9595 4 80 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9527 1 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9505 3 78 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9461 3 78 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9459 2 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2U1X9I3-F1-model_v4 deleted 0.9825 287 357
AF-A0A0N1J190-F1-model_v4 Signal transduction response regulator, receiver region domain protein 0.9573 2 76 GO:0000160
AF-A0A4Q3UW49-F1-model_v4 Response regulator transcription factor 0.952 1 80 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A537K5Z2-F1-model_v4 Response regulator 0.9514 2 105 GO:0000160
AF-A0A350Y6D3-F1-model_v4 Histidine kinase 0.9467 1 105 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0016301
GO:0032993

Map