F278748

General Info

Members Datasets Scaffolds Average Seq Length
182 118 364 227

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100002598|Ga0070698_10000259814
Length 258
Sequence VNAKRRQAATRAAAPALPPGLGQRSVNLQQREGRSQDRDGHKAKTALFDQFARLAHALANGRRLEIVDVLANGERTVEGLASETRLSVANASQHLQVLREVGLVRRRRDGNRIYYELRDPEVFDLWRNLRTVAAQHRAEVGQLADAYLGARDSLEPVTRAQLLRRLKRGEDLIVLDVRPAEEFAAGHLPPAISIPLAELRRRLRELPRDKEVVAYCRGPYCAFAHKAVRVLQQAGFRAGRLEDGLPEWRAAGLPVVGS

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2721755523 Delftia sp. HK171 Isolate Unclassified
112 2738543024 Aminobacter sp. AP02 Isolate Unclassified
113 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
114 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
115 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
116 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
117 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
118 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.96
Metatranscriptomes 1.65
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 2.75
Rhizoplane 0.55
Rhizosphere 87.91
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100002598 3300005471 Bacteria 19902
2 rootH2_10041431 3300003320 Bacteria 4538
3 Ga0068869_100901605 3300005334 Bacteria 765
4 Ga0070666_10156591 3300005335 Bacteria 1591
5 Ga0068868_100640327 3300005338 Bacteria 946
6 Ga0070689_100312105 3300005340 Bacteria 1311
7 Ga0070661_100639605 3300005344 Bacteria 863
8 Ga0070669_100037814 3300005353 Bacteria 3502
9 Ga0070675_100175529 3300005354 Bacteria 1850
10 Ga0070714_100000603 3300005435 Bacteria 25692
11 Ga0070714_100003759 3300005435 Bacteria 11387
12 Ga0070714_100066212 3300005435 Bacteria 3113
13 Ga0070708_100008788 3300005445 Bacteria 8124
14 Ga0070708_100012186 3300005445 Bacteria 7011
15 Ga0070708_100035774 3300005445 Unclassified 4328
16 Ga0070708_100346007 3300005445 Bacteria 1401
17 Ga0070681_10006784 3300005458 Bacteria 11143
18 Ga0070681_10323676 3300005458 Bacteria 1451
19 Ga0070706_100000197 3300005467 Bacteria 75627
20 Ga0070706_100001651 3300005467 Bacteria 23222
21 Ga0070706_100002642 3300005467 Bacteria 17937
22 Ga0070706_100802163 3300005467 Bacteria 871
23 Ga0070706_100819719 3300005467 Bacteria 861
24 Ga0070706_100978350 3300005467 Unclassified 780
25 Ga0070707_100001014 3300005468 Bacteria 27864
26 Ga0070707_100001663 3300005468 Bacteria 21532
27 Ga0070707_100040697 3300005468 Bacteria 4446
28 Ga0070707_100074733 3300005468 Unclassified 3268
29 Ga0070707_100250986 3300005468 Viruses 1722
30 Ga0070698_100001584 3300005471 Bacteria 25308
31 Ga0070698_100019422 3300005471 Bacteria 7134
32 Ga0070698_100030320 3300005471 Bacteria 5608
33 Ga0070698_100052860 3300005471 Bacteria 4130
34 Ga0070698_100112713 3300005471 Bacteria 2684
35 Ga0070698_100113646 3300005471 Unclassified 2672
36 Ga0070698_100917605 3300005471 Bacteria 822
37 Ga0070699_100000163 3300005518 Bacteria 63679
38 Ga0070699_100128705 3300005518 Bacteria 2231
39 Ga0070699_100249395 3300005518 Bacteria 1586
40 Ga0070699_100600333 3300005518 Bacteria 1004
41 Ga0070679_100352112 3300005530 Bacteria 1420
42 Ga0070684_100379339 3300005535 Bacteria 1302
43 Ga0070697_100000421 3300005536 Bacteria 32639
44 Ga0070697_100000697 3300005536 Bacteria 25155
45 Ga0070672_100378571 3300005543 Unclassified 1210
46 Ga0070693_100214707 3300005547 Bacteria 1257
47 Ga0070664_100212666 3300005564 Unclassified 1728
48 Ga0068857_100049178 3300005577 Bacteria 3741
49 Ga0068854_100988625 3300005578 Bacteria 744
50 Ga0068852_100209851 3300005616 Bacteria 1847
51 Ga0068859_100075385 3300005617 Bacteria 3414
52 Ga0068859_100326928 3300005617 Bacteria 1627
53 Ga0068864_100029580 3300005618 Bacteria 4641
54 Ga0068863_100008078 3300005841 Bacteria 10275
55 Ga0068863_100380946 3300005841 Bacteria 1377
56 Ga0068860_100028855 3300005843 Bacteria 5339
57 Ga0068862_100125491 3300005844 Bacteria 2266
58 Ga0081455_10001557 3300005937 Bacteria 28163
59 Ga0081455_10243409 3300005937 Bacteria 1320
60 Ga0081538_10000637 3300005981 Bacteria 38833
61 Ga0081538_10001529 3300005981 Bacteria 23732
62 Ga0081538_10012060 3300005981 Bacteria 6957
63 Ga0070717_10000600 3300006028 Bacteria 23128
64 Ga0075365_10111960 3300006038 Bacteria 1876
65 Ga0070716_100099174 3300006173 Bacteria 1782
66 Ga0075366_10251436 3300006195 Bacteria 1078
67 Ga0075428_100018604 3300006844 Bacteria 7677
68 Ga0075433_10004855 3300006852 Bacteria 10515
69 Ga0075434_100050472 3300006871 Bacteria 4133
70 Ga0075434_101113380 3300006871 Bacteria 803
71 Ga0075436_100405350 3300006914 Unclassified 988
72 Ga0097620_100075387 3300006931 Bacteria 3414
73 Ga0097620_100326931 3300006931 Bacteria 1627
74 Ga0079104_1000004 3300006946 Bacteria 444549
75 Ga0079104_1001509 3300006946 Bacteria 15453
76 Ga0105240_10998596 3300009093 Bacteria 895
77 Ga0111539_10708190 3300009094 Bacteria 1172
78 Ga0111539_11370266 3300009094 Bacteria 821
79 Ga0111539_11430787 3300009094 Bacteria 802
80 Ga0114129_10006243 3300009147 Bacteria 16896
81 Ga0105243_10000352 3300009148 Bacteria 49052
82 Ga0105249_10139249 3300009553 Bacteria 2325
83 Ga0105239_10021931 3300010375 Bacteria 7040
84 Ga0105246_10084134 3300011119 Bacteria 2275
85 Ga0157373_10002191 3300013100 Bacteria 14793
86 Ga0157371_10336467 3300013102 Bacteria 1097
87 Ga0157374_10483197 3300013296 Bacteria 1242
88 Ga0157378_10950514 3300013297 Bacteria 892
89 Ga0163163_10584568 3300014325 Bacteria 1180
90 Ga0157379_10008463 3300014968 Bacteria 8948
91 Ga0206350_11129266 3300020080 Unclassified 939
92 Ga0224712_10004105 3300022467 Bacteria 3888
93 Ga0209025_1037885 3300025294 Bacteria 2131
94 Ga0207684_10000111 3300025910 Bacteria 153495
95 Ga0207684_10000144 3300025910 Bacteria 127105
96 Ga0207684_10001050 3300025910 Bacteria 30876
97 Ga0207684_10003624 3300025910 Bacteria 15026
98 Ga0207684_10687480 3300025910 Bacteria 870
99 Ga0207707_10013291 3300025912 Bacteria 7175
100 Ga0207707_10332768 3300025912 Bacteria 1310
101 Ga0207660_10208345 3300025917 Bacteria 1530
102 Ga0207646_10000182 3300025922 Bacteria 85800
103 Ga0207646_10001199 3300025922 Bacteria 32633
104 Ga0207646_10002520 3300025922 Bacteria 21615
105 Ga0207646_10015210 3300025922 Bacteria 7280
106 Ga0207646_10198859 3300025922 Bacteria 1810
107 Ga0207664_10009761 3300025929 Bacteria 6752
108 Ga0207664_10027015 3300025929 Bacteria 4347
109 Ga0207664_10078988 3300025929 Bacteria 2670
110 Ga0207709_10000138 3300025935 Bacteria 104006
111 Ga0207665_10016927 3300025939 Bacteria 4786
112 Ga0207665_10042166 3300025939 Bacteria 3050
113 Ga0207677_10395935 3300026023 Bacteria 1170
114 Ga0207641_10174870 3300026088 Bacteria 1963
115 Ga0207641_10264877 3300026088 Bacteria 1610
116 Ga0207648_10142425 3300026089 Bacteria 2113
117 Ga0207676_10056854 3300026095 Bacteria 3078
118 Ga0207674_10055680 3300026116 Bacteria 4020
119 Ga0209281_1000003 3300027111 Bacteria 1260089
120 Ga0209281_1000005 3300027111 Bacteria 1242284
121 Ga0209968_1015135 3300027526 Bacteria 1219
122 Ga0307511_10095798 3300030521 Bacteria 1980
123 Ga0307512_10087437 3300030522 Bacteria 2195
124 Ga0307509_10072589 3300031507 Bacteria 3585
125 Ga0307408_100494170 3300031548 Bacteria 1070
126 Ga0307405_10498162 3300031731 Bacteria 976
127 Ga0307407_10114074 3300031903 Bacteria 1702
128 Ga0307412_10728423 3300031911 Bacteria 854
129 Ga0307409_100766652 3300031995 Bacteria 970
130 Ga0307416_100645484 3300032002 Bacteria 1143
131 Ga0316593_10001234 3300032168 Bacteria 5513
132 Ga0395900_0105844 3300037418 Bacteria 2890
133 Ga0395905_0804253 3300037471 Bacteria 843
134 Ga0395901_0095630 3300038443 Bacteria 3113
135 Ga0451577_0000230 3300042876 Bacteria 113101
136 Ga0451577_0000383 3300042876 Bacteria 82038
137 Ga0451577_0343080 3300042876 Bacteria 1355
138 Ga0453683_0291891 3300044673 Bacteria 1042
139 Ga0453684_0000759 3300044712 Bacteria 112043
140 Ga0453684_0001228 3300044712 Bacteria 78564
141 Ga0453684_0211480 3300044712 Bacteria 2254
142 Ga0453684_0242182 3300044712 Bacteria 2076
143 Ga0453684_0317211 3300044712 Bacteria 1766
144 Ga0451576_0000346 3300045051 Bacteria 112037
145 Ga0451576_0472516 3300045051 Bacteria 1317
146 Ga0451576_0517840 3300045051 Bacteria 1253
147 Ga0466967_0622969 3300045976 Bacteria 1066
148 Ga0495638_0001017 3300046460 Bacteria 27889
149 Ga0495580_0213648 3300046472 Bacteria 1327
150 Ga0496104_0011808 3300048907 Bacteria 7838
151 Ga0496124_0025233 3300048927 Bacteria 5387
152 Ga0501039_0139715 3300049575 Unclassified 1903
153 Ga0501040_0150529 3300049576 Bacteria 1642
154 Ga0501040_0168153 3300049576 Unclassified 1552
155 Ga0501068_0542184 3300049584 Bacteria 756
156 Ga0501072_0510076 3300049588 Unclassified 951
157 Ga0501076_0180389 3300049592 Bacteria 1721
158 Ga0501076_0506342 3300049592 Unclassified 995
159 Ga0501077_0130215 3300049593 Unclassified 1595
160 Ga0501077_0521717 3300049593 Bacteria 762
161 Ga0501079_0353378 3300049741 Unclassified 1152
162 Ga0501079_0355585 3300049741 Unclassified 1148
163 Ga0501044_0004034 3300049823 Bacteria 16467
164 Ga0501044_0029696 3300049823 Bacteria 5764
165 nmdc:mga0yw44_41557_c1 3300050492 Bacteria 2737
166 nmdc:mga0k408_142627_c1 3300050493 Bacteria 1425
167 nmdc:mga05p37_5033_c1 3300050507 Bacteria 15488
168 nmdc:mga08y16_593553_c1 3300050511 Bacteria 1117
169 nmdc:mga0n895_4188_c1 3300050512 Bacteria 11781
170 nmdc:mga0a205_40288_c1 3300050515 Bacteria 4497
171 Ga0500588_0000520 3300053146 Bacteria 6187
172 Ga0501084_0263977 3300054114 Unclassified 1454
173 Ga0501084_0556536 3300054114 Unclassified 969
174 Ga0501082_0214388 3300060353 Unclassified 1675
175 2722884268 2721755523 Bacteria 6430384
176 2739308719 2738543024 Bacteria 5603683
177 2809195117 2808606439 Bacteria 5952208
178 2839140428 2839138175 Bacteria 6549354
179 2848998714 2848992105 Bacteria 6810864
180 2855872951 2855872281 Bacteria 6964271
181 2885412684 2885409591 Bacteria 9235467
182 8055878772 8055878733 Bacteria 5907058
183 Ga0070698_100002598
184 rootH2_10041431
185 Ga0068869_100901605
186 Ga0070666_10156591
187 Ga0068868_100640327
188 Ga0070689_100312105
189 Ga0070661_100639605
190 Ga0070669_100037814
191 Ga0070675_100175529
192 Ga0070714_100000603
193 Ga0070714_100003759
194 Ga0070714_100066212
195 Ga0070708_100008788
196 Ga0070708_100012186
197 Ga0070708_100035774
198 Ga0070708_100346007
199 Ga0070681_10006784
200 Ga0070681_10323676
201 Ga0070706_100000197
202 Ga0070706_100001651
203 Ga0070706_100002642
204 Ga0070706_100802163
205 Ga0070706_100819719
206 Ga0070706_100978350
207 Ga0070707_100001014
208 Ga0070707_100001663
209 Ga0070707_100040697
210 Ga0070707_100074733
211 Ga0070707_100250986
212 Ga0070698_100001584
213 Ga0070698_100019422
214 Ga0070698_100030320
215 Ga0070698_100052860
216 Ga0070698_100112713
217 Ga0070698_100113646
218 Ga0070698_100917605
219 Ga0070699_100000163
220 Ga0070699_100128705
221 Ga0070699_100249395
222 Ga0070699_100600333
223 Ga0070679_100352112
224 Ga0070684_100379339
225 Ga0070697_100000421
226 Ga0070697_100000697
227 Ga0070672_100378571
228 Ga0070693_100214707
229 Ga0070664_100212666
230 Ga0068857_100049178
231 Ga0068854_100988625
232 Ga0068852_100209851
233 Ga0068859_100075385
234 Ga0068859_100326928
235 Ga0068864_100029580
236 Ga0068863_100008078
237 Ga0068863_100380946
238 Ga0068860_100028855
239 Ga0068862_100125491
240 Ga0081455_10001557
241 Ga0081455_10243409
242 Ga0081538_10000637
243 Ga0081538_10001529
244 Ga0081538_10012060
245 Ga0070717_10000600
246 Ga0075365_10111960
247 Ga0070716_100099174
248 Ga0075366_10251436
249 Ga0075428_100018604
250 Ga0075433_10004855
251 Ga0075434_100050472
252 Ga0075434_101113380
253 Ga0075436_100405350
254 Ga0097620_100075387
255 Ga0097620_100326931
256 Ga0079104_1000004
257 Ga0079104_1001509
258 Ga0105240_10998596
259 Ga0111539_10708190
260 Ga0111539_11370266
261 Ga0111539_11430787
262 Ga0114129_10006243
263 Ga0105243_10000352
264 Ga0105249_10139249
265 Ga0105239_10021931
266 Ga0105246_10084134
267 Ga0157373_10002191
268 Ga0157371_10336467
269 Ga0157374_10483197
270 Ga0157378_10950514
271 Ga0163163_10584568
272 Ga0157379_10008463
273 Ga0206350_11129266
274 Ga0224712_10004105
275 Ga0209025_1037885
276 Ga0207684_10000111
277 Ga0207684_10000144
278 Ga0207684_10001050
279 Ga0207684_10003624
280 Ga0207684_10687480
281 Ga0207707_10013291
282 Ga0207707_10332768
283 Ga0207660_10208345
284 Ga0207646_10000182
285 Ga0207646_10001199
286 Ga0207646_10002520
287 Ga0207646_10015210
288 Ga0207646_10198859
289 Ga0207664_10009761
290 Ga0207664_10027015
291 Ga0207664_10078988
292 Ga0207709_10000138
293 Ga0207665_10016927
294 Ga0207665_10042166
295 Ga0207677_10395935
296 Ga0207641_10174870
297 Ga0207641_10264877
298 Ga0207648_10142425
299 Ga0207676_10056854
300 Ga0207674_10055680
301 Ga0209281_1000003
302 Ga0209281_1000005
303 Ga0209968_1015135
304 Ga0307511_10095798
305 Ga0307512_10087437
306 Ga0307509_10072589
307 Ga0307408_100494170
308 Ga0307405_10498162
309 Ga0307407_10114074
310 Ga0307412_10728423
311 Ga0307409_100766652
312 Ga0307416_100645484
313 Ga0316593_10001234
314 Ga0395900_0105844
315 Ga0395905_0804253
316 Ga0395901_0095630
317 Ga0451577_0000230
318 Ga0451577_0000383
319 Ga0451577_0343080
320 Ga0453683_0291891
321 Ga0453684_0000759
322 Ga0453684_0001228
323 Ga0453684_0211480
324 Ga0453684_0242182
325 Ga0453684_0317211
326 Ga0451576_0000346
327 Ga0451576_0472516
328 Ga0451576_0517840
329 Ga0466967_0622969
330 Ga0495638_0001017
331 Ga0495580_0213648
332 Ga0496104_0011808
333 Ga0496124_0025233
334 Ga0501039_0139715
335 Ga0501040_0150529
336 Ga0501040_0168153
337 Ga0501068_0542184
338 Ga0501072_0510076
339 Ga0501076_0180389
340 Ga0501076_0506342
341 Ga0501077_0130215
342 Ga0501077_0521717
343 Ga0501079_0353378
344 Ga0501079_0355585
345 Ga0501044_0004034
346 Ga0501044_0029696
347 nmdc:mga0yw44_41557_c1
348 nmdc:mga0k408_142627_c1
349 nmdc:mga05p37_5033_c1
350 nmdc:mga08y16_593553_c1
351 nmdc:mga0n895_4188_c1
352 nmdc:mga0a205_40288_c1
353 Ga0500588_0000520
354 Ga0501084_0263977
355 Ga0501084_0556536
356 Ga0501082_0214388
357 2722884268
358 2739308719
359 2809195117
360 2839140428
361 2848998714
362 2855872951
363 2885412684
364 8055878772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

60

106

0.96

PF12840

HTH_20

Helix-turn-helix domain

58

107

0.95

PF00581

Rhodanese

Rhodanese-like domain

158

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gw2-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e. 0.9465 5 96
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9436 34 79
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.9385 118 217
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9321 34 79
3flh-assembly1.cif.gz_A crystal structure of lp_1913 protein from lactobacillus plantarum,northeast structural genomics consortium target lpr140b 0.9319 117 217
ID Description Score Start End Superfamily
af_O53921_2_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9899 3 101 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9829 35 79 3.30.230.130
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9772 24 78 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 21 77 1.10.10.10
af_O08446_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.968 2 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2E0SP54-F1-model_v4 Transcriptional regulator 0.9821 12 79 GO:0003700
AF-A0A4Z0EK90-F1-model_v4 Rhodanese-like domain-containing protein 0.9784 123 220
AF-M3HKB8-F1-model_v4 Transcriptional regulator, ArsR family 0.9772 10 78 GO:0003700
AF-A0A843K0U0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9768 10 94 GO:0003700
AF-A0A133VC86-F1-model_v4 HTH arsR-type domain-containing protein 0.9758 9 79 GO:0003700

Map