F278591

General Info

Members Datasets Scaffolds Average Seq Length
182 99 364 350

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100093793|Ga0070661_1000937932
Length 420
Sequence MTLAARPARLWLIAKSLCPSNAFQTAIRLPVDIDNFTDYCPFLKTLWRLAPPGNSVTGLERHGIPIAEARGVGMKVQGAPGPLMNGYVDPALVPHRILYTGARMPAIGLGTFGSDHVTASEVAAAVEDAAAAGYRHFDCASVYSNEHEIGYALEQVLKRYLDREKLWVTSKLWNDKHDENDVVASCRKSVTDLRVGYLDLYLVHWPFPNFHPPGCDVSSRSQDAKPYIHAEFMKTWRKMEELVELGLVRHIGTSNMTVPKLRPLLRDARIKPAVNQMELHPHFQQPELFDFVRSNGMVPVGYCPVGSPGRPERDRTAEDTVPTQDPVIVKIANRLGVHPAVVCVKWAVQRGQVPIPFSTNRSHYLSNLEGVMSEPLTEGEMSEIGAIDRNCRLIKGQVFLWKEGQSWEDLWDLNGEITPP

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.3
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 18.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100093793 3300005344 Unclassified 2224
2 Ga0070680_100212004 3300005336 Bacteria 1634
3 Ga0070709_10087666 3300005434 Unclassified 2045
4 Ga0070713_100039220 3300005436 Bacteria 3843
5 Ga0070713_100099958 3300005436 Bacteria 2510
6 Ga0070708_100001594 3300005445 Bacteria 17384
7 Ga0070706_100002924 3300005467 Bacteria 17001
8 Ga0070706_100005513 3300005467 Bacteria 12048
9 Ga0070707_100069847 3300005468 Unclassified 3382
10 Ga0070707_100283802 3300005468 Bacteria 1609
11 Ga0070679_100038641 3300005530 Bacteria 4746
12 Ga0070697_100001045 3300005536 Bacteria 20921
13 Ga0070665_100000037 3300005548 Bacteria 312727
14 Ga0070665_100002902 3300005548 Bacteria 18512
15 Ga0070665_100114089 3300005548 Bacteria 2705
16 Ga0070665_100358124 3300005548 Bacteria 1465
17 Ga0068855_100275998 3300005563 Bacteria 1868
18 Ga0068854_100174112 3300005578 Bacteria 1677
19 Ga0068856_100009573 3300005614 Bacteria 9410
20 Ga0068856_100024490 3300005614 Bacteria 5877
21 Ga0070717_10012748 3300006028 Bacteria 6416
22 Ga0070717_10106783 3300006028 Unclassified 2384
23 Ga0070717_10291730 3300006028 Bacteria 1448
24 Ga0070715_10107747 3300006163 Bacteria 1310
25 Ga0070716_100047804 3300006173 Bacteria 2415
26 Ga0070712_100089338 3300006175 Bacteria 2253
27 Ga0070712_100152077 3300006175 Unclassified 1778
28 Ga0070712_100205801 3300006175 Bacteria 1549
29 Ga0097621_100008858 3300006237 Bacteria 7275
30 Ga0097621_100175271 3300006237 Bacteria 1851
31 Ga0068871_100004663 3300006358 Bacteria 9579
32 Ga0068871_100124464 3300006358 Bacteria 2181
33 Ga0075435_100089123 3300007076 Bacteria 2543
34 Ga0105240_10001854 3300009093 Bacteria 35375
35 Ga0105240_10002057 3300009093 Bacteria 32991
36 Ga0105240_10005692 3300009093 Bacteria 18497
37 Ga0105240_10010446 3300009093 Bacteria 13045
38 Ga0105240_10182031 3300009093 Unclassified 2479
39 Ga0105241_10005169 3300009174 Bacteria 9627
40 Ga0105241_10079681 3300009174 Unclassified 2562
41 Ga0105237_10019982 3300009545 Bacteria 6914
42 Ga0105237_10052293 3300009545 Unclassified 4101
43 Ga0105237_10293877 3300009545 Unclassified 1627
44 Ga0105238_10033704 3300009551 Bacteria 5211
45 Ga0157369_10055215 3300013105 Unclassified 4288
46 Ga0157369_10115156 3300013105 Unclassified 2855
47 Ga0157369_10210668 3300013105 Bacteria 2037
48 Ga0157374_10255078 3300013296 Unclassified 1726
49 Ga0157378_10008726 3300013297 Bacteria 8822
50 Ga0157378_10037418 3300013297 Bacteria 4297
51 Ga0163162_10002120 3300013306 Bacteria 18637
52 Ga0163162_10050717 3300013306 Bacteria 4161
53 Ga0163162_10659256 3300013306 Bacteria 1170
54 Ga0157372_10017213 3300013307 Bacteria 7759
55 Ga0157372_10039356 3300013307 Bacteria 5218
56 Ga0157372_10197544 3300013307 Bacteria 2330
57 Ga0163163_10098634 3300014325 Bacteria 2943
58 Ga0157379_10087232 3300014968 Unclassified 2798
59 Ga0157379_10095219 3300014968 Unclassified 2672
60 Ga0157376_10144279 3300014969 Unclassified 2140
61 Ga0157376_10221764 3300014969 Bacteria 1751
62 Ga0213875_10032669 3300021388 Unclassified 2458
63 Ga0207685_10086575 3300025905 Bacteria 1309
64 Ga0207699_10073714 3300025906 Unclassified 2095
65 Ga0207699_10270178 3300025906 Bacteria 1178
66 Ga0207684_10001203 3300025910 Bacteria 28825
67 Ga0207684_10006189 3300025910 Bacteria 10931
68 Ga0207654_10012624 3300025911 Unclassified 4332
69 Ga0207654_10025210 3300025911 Unclassified 3205
70 Ga0207707_10156067 3300025912 Unclassified 1996
71 Ga0207707_10275109 3300025912 Bacteria 1459
72 Ga0207695_10007831 3300025913 Bacteria 13516
73 Ga0207695_10009745 3300025913 Bacteria 11824
74 Ga0207695_10013830 3300025913 Bacteria 9600
75 Ga0207671_10055010 3300025914 Bacteria 2948
76 Ga0207671_10334725 3300025914 Bacteria 1199
77 Ga0207693_10002642 3300025915 Bacteria 15567
78 Ga0207693_10047926 3300025915 Bacteria 3357
79 Ga0207693_10066929 3300025915 Bacteria 2813
80 Ga0207693_10146741 3300025915 Bacteria 1855
81 Ga0207693_10195383 3300025915 Unclassified 1592
82 Ga0207652_10034549 3300025921 Bacteria 4261
83 Ga0207652_10105546 3300025921 Bacteria 2493
84 Ga0207646_10136115 3300025922 Bacteria 2212
85 Ga0207646_10240974 3300025922 Bacteria 1634
86 Ga0207694_10058583 3300025924 Unclassified 2996
87 Ga0207700_10082198 3300025928 Bacteria 2518
88 Ga0207700_10165848 3300025928 Bacteria 1838
89 Ga0207700_10176061 3300025928 Bacteria 1788
90 Ga0207706_10016818 3300025933 Bacteria 6601
91 Ga0207670_10080077 3300025936 Bacteria 2282
92 Ga0207665_10349147 3300025939 Bacteria 1116
93 Ga0207711_10061484 3300025941 Bacteria 3238
94 Ga0207661_10034110 3300025944 Bacteria 3955
95 Ga0207661_10054751 3300025944 Bacteria 3197
96 Ga0207667_10274453 3300025949 Unclassified 1723
97 Ga0207708_10077867 3300026075 Bacteria 2545
98 Ga0207702_10018971 3300026078 Bacteria 5691
99 Ga0207702_10297287 3300026078 Unclassified 1531
100 Ga0207648_10011239 3300026089 Bacteria 8440
101 Ga0207683_10293292 3300026121 Bacteria 1487
102 Ga0268266_10000046 3300028379 Bacteria 312745
103 Ga0268266_10085889 3300028379 Bacteria 2750
104 Ga0268266_10086765 3300028379 Bacteria 2737
105 Ga0265334_10021357 3300028573 Bacteria 2644
106 Ga0265318_10005388 3300028577 Bacteria 6008
107 Ga0265323_10000750 3300028653 Bacteria 17440
108 Ga0265336_10006774 3300028666 Bacteria 4106
109 Ga0265338_10011578 3300028800 Bacteria 10170
110 Ga0265338_10062028 3300028800 Bacteria 3271
111 Ga0265330_10001343 3300031235 Bacteria 14383
112 Ga0265330_10004234 3300031235 Bacteria 7316
113 Ga0265330_10005092 3300031235 Bacteria 6587
114 Ga0265330_10005415 3300031235 Bacteria 6365
115 Ga0265328_10003067 3300031239 Bacteria 7455
116 Ga0265325_10000601 3300031241 Bacteria 26233
117 Ga0265329_10008973 3300031242 Unclassified 3758
118 Ga0265329_10039027 3300031242 Bacteria 1527
119 Ga0265340_10001842 3300031247 Bacteria 12107
120 Ga0265340_10016564 3300031247 Bacteria 3817
121 Ga0265340_10023647 3300031247 Bacteria 3131
122 Ga0265339_10000005 3300031249 Bacteria 262324
123 Ga0265339_10002613 3300031249 Bacteria 12856
124 Ga0265339_10003180 3300031249 Bacteria 11544
125 Ga0265339_10004881 3300031249 Bacteria 9050
126 Ga0265339_10016226 3300031249 Bacteria 4446
127 Ga0265316_10000868 3300031344 Bacteria 33294
128 Ga0265316_10003810 3300031344 Bacteria 15143
129 Ga0265316_10004175 3300031344 Bacteria 14438
130 Ga0265316_10029377 3300031344 Bacteria 4522
131 Ga0265316_10035360 3300031344 Bacteria 4049
132 Ga0265316_10062876 3300031344 Bacteria 2880
133 Ga0265316_10072945 3300031344 Bacteria 2644
134 Ga0265316_10102955 3300031344 Bacteria 2168
135 Ga0265316_10162293 3300031344 Unclassified 1670
136 Ga0265313_10000799 3300031595 Bacteria 31885
137 Ga0265313_10008824 3300031595 Bacteria 6640
138 Ga0265314_10000033 3300031711 Bacteria 254594
139 Ga0265314_10042426 3300031711 Bacteria 3245
140 Ga0265314_10067201 3300031711 Bacteria 2415
141 Ga0265342_10000078 3300031712 Bacteria 105279
142 Ga0265342_10004103 3300031712 Bacteria 11612
143 Ga0265342_10006646 3300031712 Bacteria 8579
144 Ga0265342_10007059 3300031712 Bacteria 8280
145 Ga0265342_10014487 3300031712 Bacteria 5232
146 Ga0265342_10045879 3300031712 Unclassified 2628
147 Ga0316576_10001112 3300031727 Bacteria 14055
148 Ga0316578_10097645 3300031728 Bacteria 1759
149 Ga0373931_0026089 3300035691 Bacteria 2970
150 Ga0373935_0038819 3300035692 Unclassified 2983
151 Ga0373933_0036598 3300035724 Unclassified 2874
152 Ga0373947_0087278 3300035725 Bacteria 1940
153 Ga0373937_0060408 3300036401 Bacteria 3484
154 Ga0316582_0194974 3300036647 Bacteria 1381
155 Ga0373925_0013987 3300037068 Bacteria 5809
156 Ga0373925_0015350 3300037068 Bacteria 5541
157 Ga0373925_0171770 3300037068 Bacteria 1712
158 Ga0436364_1236344 3300037853 Bacteria 26268
159 Ga0436364_1464835 3300037853 Bacteria 18619
160 Ga0436364_1558684 3300037853 Bacteria 4084
161 Ga0436361_1112376 3300039447 Bacteria 4682
162 Ga0436363_0041511 3300039450 Bacteria 1593
163 Ga0453684_0011827 3300044712 Bacteria 14545
164 Ga0453684_0039060 3300044712 Bacteria 6474
165 Ga0453684_0316950 3300044712 Bacteria 1767
166 Ga0495651_0061987 3300046462 Bacteria 2862
167 Ga0495580_0126488 3300046472 Bacteria 1774
168 Ga0495664_0020023 3300046477 Bacteria 3855
169 Ga0495645_0043566 3300046543 Bacteria 3274
170 Ga0495667_0189541 3300046559 Bacteria 1318
171 Ga0495623_0082176 3300046679 Unclassified 1991
172 Ga0495674_0003774 3300047319 Bacteria 14734
173 Ga0495675_0071817 3300047444 Bacteria 2184
174 Ga0495684_0000267 3300047471 Bacteria 41592
175 Ga0495684_0005177 3300047471 Bacteria 10164
176 Ga0496100_0061848 3300048903 Unclassified 2468
177 Ga0496101_0037317 3300048904 Unclassified 3447
178 Ga0496102_0015444 3300048905 Bacteria 6650
179 Ga0496102_0095752 3300048905 Bacteria 2752
180 Ga0496112_0059499 3300048915 Unclassified 3765
181 Ga0496115_0035698 3300048918 Unclassified 3934
182 2920114682 2920107658 Bacteria 10042636
183 Ga0070661_100093793
184 Ga0070680_100212004
185 Ga0070709_10087666
186 Ga0070713_100039220
187 Ga0070713_100099958
188 Ga0070708_100001594
189 Ga0070706_100002924
190 Ga0070706_100005513
191 Ga0070707_100069847
192 Ga0070707_100283802
193 Ga0070679_100038641
194 Ga0070697_100001045
195 Ga0070665_100000037
196 Ga0070665_100002902
197 Ga0070665_100114089
198 Ga0070665_100358124
199 Ga0068855_100275998
200 Ga0068854_100174112
201 Ga0068856_100009573
202 Ga0068856_100024490
203 Ga0070717_10012748
204 Ga0070717_10106783
205 Ga0070717_10291730
206 Ga0070715_10107747
207 Ga0070716_100047804
208 Ga0070712_100089338
209 Ga0070712_100152077
210 Ga0070712_100205801
211 Ga0097621_100008858
212 Ga0097621_100175271
213 Ga0068871_100004663
214 Ga0068871_100124464
215 Ga0075435_100089123
216 Ga0105240_10001854
217 Ga0105240_10002057
218 Ga0105240_10005692
219 Ga0105240_10010446
220 Ga0105240_10182031
221 Ga0105241_10005169
222 Ga0105241_10079681
223 Ga0105237_10019982
224 Ga0105237_10052293
225 Ga0105237_10293877
226 Ga0105238_10033704
227 Ga0157369_10055215
228 Ga0157369_10115156
229 Ga0157369_10210668
230 Ga0157374_10255078
231 Ga0157378_10008726
232 Ga0157378_10037418
233 Ga0163162_10002120
234 Ga0163162_10050717
235 Ga0163162_10659256
236 Ga0157372_10017213
237 Ga0157372_10039356
238 Ga0157372_10197544
239 Ga0163163_10098634
240 Ga0157379_10087232
241 Ga0157379_10095219
242 Ga0157376_10144279
243 Ga0157376_10221764
244 Ga0213875_10032669
245 Ga0207685_10086575
246 Ga0207699_10073714
247 Ga0207699_10270178
248 Ga0207684_10001203
249 Ga0207684_10006189
250 Ga0207654_10012624
251 Ga0207654_10025210
252 Ga0207707_10156067
253 Ga0207707_10275109
254 Ga0207695_10007831
255 Ga0207695_10009745
256 Ga0207695_10013830
257 Ga0207671_10055010
258 Ga0207671_10334725
259 Ga0207693_10002642
260 Ga0207693_10047926
261 Ga0207693_10066929
262 Ga0207693_10146741
263 Ga0207693_10195383
264 Ga0207652_10034549
265 Ga0207652_10105546
266 Ga0207646_10136115
267 Ga0207646_10240974
268 Ga0207694_10058583
269 Ga0207700_10082198
270 Ga0207700_10165848
271 Ga0207700_10176061
272 Ga0207706_10016818
273 Ga0207670_10080077
274 Ga0207665_10349147
275 Ga0207711_10061484
276 Ga0207661_10034110
277 Ga0207661_10054751
278 Ga0207667_10274453
279 Ga0207708_10077867
280 Ga0207702_10018971
281 Ga0207702_10297287
282 Ga0207648_10011239
283 Ga0207683_10293292
284 Ga0268266_10000046
285 Ga0268266_10085889
286 Ga0268266_10086765
287 Ga0265334_10021357
288 Ga0265318_10005388
289 Ga0265323_10000750
290 Ga0265336_10006774
291 Ga0265338_10011578
292 Ga0265338_10062028
293 Ga0265330_10001343
294 Ga0265330_10004234
295 Ga0265330_10005092
296 Ga0265330_10005415
297 Ga0265328_10003067
298 Ga0265325_10000601
299 Ga0265329_10008973
300 Ga0265329_10039027
301 Ga0265340_10001842
302 Ga0265340_10016564
303 Ga0265340_10023647
304 Ga0265339_10000005
305 Ga0265339_10002613
306 Ga0265339_10003180
307 Ga0265339_10004881
308 Ga0265339_10016226
309 Ga0265316_10000868
310 Ga0265316_10003810
311 Ga0265316_10004175
312 Ga0265316_10029377
313 Ga0265316_10035360
314 Ga0265316_10062876
315 Ga0265316_10072945
316 Ga0265316_10102955
317 Ga0265316_10162293
318 Ga0265313_10000799
319 Ga0265313_10008824
320 Ga0265314_10000033
321 Ga0265314_10042426
322 Ga0265314_10067201
323 Ga0265342_10000078
324 Ga0265342_10004103
325 Ga0265342_10006646
326 Ga0265342_10007059
327 Ga0265342_10014487
328 Ga0265342_10045879
329 Ga0316576_10001112
330 Ga0316578_10097645
331 Ga0373931_0026089
332 Ga0373935_0038819
333 Ga0373933_0036598
334 Ga0373947_0087278
335 Ga0373937_0060408
336 Ga0316582_0194974
337 Ga0373925_0013987
338 Ga0373925_0015350
339 Ga0373925_0171770
340 Ga0436364_1236344
341 Ga0436364_1464835
342 Ga0436364_1558684
343 Ga0436361_1112376
344 Ga0436363_0041511
345 Ga0453684_0011827
346 Ga0453684_0039060
347 Ga0453684_0316950
348 Ga0495651_0061987
349 Ga0495580_0126488
350 Ga0495664_0020023
351 Ga0495645_0043566
352 Ga0495667_0189541
353 Ga0495623_0082176
354 Ga0495674_0003774
355 Ga0495675_0071817
356 Ga0495684_0000267
357 Ga0495684_0005177
358 Ga0496100_0061848
359 Ga0496101_0037317
360 Ga0496102_0015444
361 Ga0496102_0095752
362 Ga0496112_0059499
363 Ga0496115_0035698
364 2920114682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

106

389

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mhb-assembly4.cif.gz_D structure of a putative reductase from yersinia pestis 0.9499 21 315
4mhb-assembly1.cif.gz_A structure of a putative reductase from yersinia pestis 0.9492 21 315
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.9485 22 316
3o0k-assembly3.cif.gz_C crystal structure of aldo/keto reductase from brucella melitensis 0.9392 20 315
5jh1-assembly1.cif.gz_A crystal structure of the apo form of akr4c7 from maize 0.9388 22 315
ID Description Score Start End Superfamily
af_Q5T2L2_5_129_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9498 22 134 3.20.20.100
5jh1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9388 22 315 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9386 19 315 3.20.20.100
af_C7IWJ1_1_81_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9385 22 100 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9381 21 316 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A357Z4G6-F1-model_v4 Aldo/keto reductase 0.9658 10 104 GO:0016491
AF-A0A2G5NQ56-F1-model_v4 Aldo/keto reductase 0.9548 21 323 GO:0004033
GO:0044281
AF-A0A836KC17-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.949 19 320 GO:0004033
GO:0044281
AF-A0A0X3PRH5-F1-model_v4 Aldose reductase 0.9473 20 320 GO:0016491
AF-A0A430JSR6-F1-model_v4 Aldo/keto reductase 0.946 22 316 GO:0004033
GO:0044281

Map