F278547

General Info

Members Datasets Scaffolds Average Seq Length
182 138 364 137

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100474121|Ga0068869_1004741211
Length 149
Sequence MPTRNGSAVWEGTLREGKGTVRLGSGAYEGQYSFSSRFEEGTGTNPEELIGAAHAGCFSMALAAALTKAGITPKKISTTAKVHLGQAEGGFAITSIELETVGEVPGIDEKTFLEHAEGAKKNCPVSKALAGTQIALNAKIVTSDKDSDK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
137 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
138 2848858292 Azospirillum brasilense Az39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 1.65
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 9.34
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 19.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100474121 3300005334 Bacteria 1041
2 MBSR1b_contig_12936078 2162886012 Bacteria 822
3 MBSR1b_contig_13410014 2162886012 Bacteria 822
4 MBSR1b_contig_1836369 2162886012 Bacteria 892
5 Ga0065715_10063162 3300005293 Bacteria 775
6 Ga0070690_100180365 3300005330 Unclassified 1459
7 Ga0070680_100259384 3300005336 Unclassified 1470
8 Ga0070682_100271993 3300005337 Bacteria 1231
9 Ga0070689_101878556 3300005340 Unclassified 547
10 Ga0070687_100637966 3300005343 Unclassified 737
11 Ga0070703_10026957 3300005406 Unclassified 1710
12 Ga0070705_100213812 3300005440 Unclassified 1331
13 Ga0070705_100292838 3300005440 Bacteria 1163
14 Ga0070705_101610663 3300005440 Bacteria 547
15 Ga0070708_100272150 3300005445 Bacteria 1593
16 Ga0070685_10334982 3300005466 Unclassified 1030
17 Ga0070706_101303190 3300005467 Bacteria 666
18 Ga0070707_100016699 3300005468 Bacteria 6891
19 Ga0070707_100058832 3300005468 Bacteria 3686
20 Ga0070699_100494778 3300005518 Bacteria 1110
21 Ga0070672_101027170 3300005543 Unclassified 731
22 Ga0070686_100230726 3300005544 Unclassified 1343
23 Ga0070686_100307832 3300005544 Bacteria 1177
24 Ga0070695_100053738 3300005545 Bacteria 2591
25 Ga0070695_100341404 3300005545 Bacteria 1119
26 Ga0070696_101527129 3300005546 Bacteria 572
27 Ga0070704_100072514 3300005549 Bacteria 2505
28 Ga0068857_100366964 3300005577 Unclassified 1335
29 Ga0070702_100161610 3300005615 Unclassified 1448
30 Ga0070702_100812603 3300005615 Bacteria 724
31 Ga0068864_100452783 3300005618 Unclassified 1228
32 Ga0068863_100274713 3300005841 Bacteria 1632
33 Ga0068858_100842091 3300005842 Unclassified 896
34 Ga0068860_100837396 3300005843 Bacteria 934
35 Ga0070717_11358108 3300006028 Bacteria 646
36 Ga0075365_10000193 3300006038 Bacteria 20067
37 Ga0075365_10001394 3300006038 Bacteria 10893
38 Ga0075365_11237060 3300006038 Bacteria 525
39 Ga0070712_100974357 3300006175 Bacteria 733
40 Ga0075428_100013681 3300006844 Bacteria 9033
41 Ga0075428_100328200 3300006844 Bacteria 1644
42 Ga0075428_100336931 3300006844 Bacteria 1620
43 Ga0075430_101484834 3300006846 Bacteria 557
44 Ga0075431_100329732 3300006847 Bacteria 1537
45 Ga0075433_10000579 3300006852 Bacteria 24211
46 Ga0075433_11030509 3300006852 Bacteria 716
47 Ga0075434_100012271 3300006871 Bacteria 8121
48 Ga0075434_101123217 3300006871 Unclassified 799
49 Ga0068865_101993422 3300006881 Bacteria 527
50 Ga0075436_100020748 3300006914 Bacteria 4508
51 Ga0075435_100001223 3300007076 Bacteria 16439
52 Ga0075435_100456495 3300007076 Bacteria 1102
53 Ga0111539_10018763 3300009094 Bacteria 8560
54 Ga0105245_10012310 3300009098 Bacteria 7443
55 Ga0114129_10109761 3300009147 Bacteria 3808
56 Ga0114129_10175343 3300009147 Bacteria 2920
57 Ga0105242_11491463 3300009176 Bacteria 707
58 Ga0105248_10174743 3300009177 Bacteria 2421
59 Ga0105248_10885409 3300009177 Bacteria 1008
60 Ga0105249_11194130 3300009553 Bacteria 832
61 Ga0105249_13549958 3300009553 Unclassified 502
62 Ga0105239_10240594 3300010375 Unclassified 2031
63 Ga0105246_10038047 3300011119 Bacteria 3232
64 Ga0105246_10331009 3300011119 Bacteria 1241
65 Ga0157378_10045995 3300013297 Bacteria 3880
66 Ga0157378_12039416 3300013297 Bacteria 624
67 Ga0163162_10089419 3300013306 Bacteria 3160
68 Ga0157375_10036037 3300013308 Bacteria 4728
69 Ga0157375_10067488 3300013308 Bacteria 3574
70 Ga0163163_11346053 3300014325 Bacteria 776
71 Ga0157380_10294240 3300014326 Bacteria 1492
72 Ga0157380_12666720 3300014326 Bacteria 566
73 Ga0163161_10315029 3300017792 Unclassified 1235
74 Ga0206356_10552004 3300020070 Bacteria 504
75 Ga0206356_11290606 3300020070 Bacteria 710
76 Ga0224712_10325476 3300022467 Bacteria 723
77 Ga0207653_10339021 3300025885 Bacteria 586
78 Ga0207688_10041373 3300025901 Bacteria 2563
79 Ga0207643_10350912 3300025908 Unclassified 926
80 Ga0207684_10197145 3300025910 Bacteria 1737
81 Ga0207660_11186199 3300025917 Bacteria 621
82 Ga0207662_10551945 3300025918 Unclassified 798
83 Ga0207646_10023341 3300025922 Bacteria 5683
84 Ga0207646_10066485 3300025922 Bacteria 3219
85 Ga0207659_10400297 3300025926 Unclassified 1148
86 Ga0207711_10449374 3300025941 Unclassified 1200
87 Ga0207679_11921066 3300025945 Unclassified 540
88 Ga0207674_10422095 3300026116 Bacteria 1289
89 Ga0207675_100303430 3300026118 Bacteria 1556
90 Ga0207683_10750358 3300026121 Bacteria 905
91 Ga0207428_10026897 3300027907 Bacteria 4793
92 Ga0268265_12311281 3300028380 Bacteria 544
93 Ga0268264_11970965 3300028381 Unclassified 593
94 Ga0265323_10047525 3300028653 Bacteria 1535
95 Ga0265327_10083906 3300031251 Bacteria 1566
96 Ga0307405_11611532 3300031731 Bacteria 573
97 Ga0307413_11597726 3300031824 Unclassified 579
98 Ga0307410_10487699 3300031852 Bacteria 1012
99 Ga0307410_10884196 3300031852 Unclassified 764
100 Ga0307406_10155261 3300031901 Unclassified 1638
101 Ga0307406_10568992 3300031901 Bacteria 930
102 Ga0307407_10237991 3300031903 Bacteria 1240
103 Ga0307409_101997894 3300031995 Unclassified 609
104 Ga0307416_100374086 3300032002 Bacteria 1452
105 Ga0307416_101117957 3300032002 Bacteria 893
106 Ga0307414_11632542 3300032004 Unclassified 601
107 Ga0307411_11522497 3300032005 Bacteria 615
108 Ga0307415_100553406 3300032126 Bacteria 1016
109 Ga0307415_100852805 3300032126 Bacteria 836
110 Ga0373931_0098294 3300035691 Bacteria 1642
111 Ga0395905_1129560 3300037471 Bacteria 687
112 Ga0395901_1117278 3300038443 Bacteria 758
113 Ga0451577_0045091 3300042876 Bacteria 3947
114 Ga0453683_0167567 3300044673 Bacteria 1391
115 Ga0453684_0017962 3300044712 Bacteria 10897
116 Ga0453684_0038821 3300044712 Bacteria 6499
117 Ga0453684_1075900 3300044712 Bacteria 851
118 Ga0451576_0960002 3300045051 Bacteria 896
119 Ga0495668_0006308 3300046616 Bacteria 7807
120 Ga0495635_0591218 3300046663 Bacteria 725
121 Ga0495680_0516682 3300047322 Bacteria 809
122 Ga0496100_0008602 3300048903 Bacteria 5698
123 Ga0496101_1359728 3300048904 Bacteria 554
124 Ga0496102_0009384 3300048905 Bacteria 8404
125 Ga0496103_0001813 3300048906 Bacteria 13894
126 Ga0496104_0117035 3300048907 Bacteria 2557
127 Ga0496105_0181113 3300048908 Bacteria 1725
128 Ga0496106_0168021 3300048909 Bacteria 1737
129 Ga0496107_1021226 3300048910 Bacteria 599
130 Ga0496108_0031056 3300048911 Bacteria 4429
131 Ga0496109_0010430 3300048912 Bacteria 7936
132 Ga0496110_0092556 3300048913 Bacteria 2705
133 Ga0496111_0010333 3300048914 Bacteria 6259
134 Ga0496111_1130983 3300048914 Bacteria 557
135 Ga0496112_0021829 3300048915 Bacteria 6092
136 Ga0496113_0006836 3300048916 Bacteria 7275
137 Ga0496114_0060598 3300048917 Bacteria 3163
138 Ga0496115_0008246 3300048918 Bacteria 7700
139 Ga0501031_0958632 3300049568 Bacteria 547
140 Ga0501034_0254422 3300049571 Bacteria 1700
141 Ga0501036_0662559 3300049572 Bacteria 864
142 Ga0501040_0617461 3300049576 Unclassified 783
143 Ga0501042_0580655 3300049578 Unclassified 815
144 Ga0501046_0007923 3300049580 Bacteria 9300
145 Ga0501071_0475077 3300049587 Bacteria 958
146 Ga0501075_0115032 3300049591 Bacteria 2045
147 Ga0501075_0223630 3300049591 Bacteria 1436
148 Ga0501076_0020801 3300049592 Bacteria 5025
149 Ga0501225_0255799 3300049705 Bacteria 578
150 Ga0501079_0551846 3300049741 Unclassified 906
151 Ga0501079_1510742 3300049741 Bacteria 528
152 Ga0501080_0209301 3300049742 Bacteria 1787
153 Ga0501081_0133763 3300049743 Unclassified 1773
154 Ga0501083_0509790 3300049744 Unclassified 783
155 Ga0501044_0108975 3300049823 Bacteria 2779
156 Ga0501045_0173496 3300049824 Bacteria 1606
157 Ga0501045_0846596 3300049824 Bacteria 673
158 nmdc:mga03n38_173297_c1 3300050490 Bacteria 1100
159 nmdc:mga0yw44_482483_c1 3300050492 Bacteria 841
160 nmdc:mga05p37_10090_c1 3300050507 Bacteria 11210
161 nmdc:mga05p37_1186295_c1 3300050507 Unclassified 790
162 nmdc:mga05p37_141213_c1 3300050507 Bacteria 2951
163 nmdc:mga0qj67_428892_c1 3300050509 Bacteria 1066
164 nmdc:mga0qj67_684227_c1 3300050509 Bacteria 817
165 nmdc:mga06r32_1051191_c1 3300050510 Bacteria 765
166 nmdc:mga06r32_143809_c1 3300050510 Bacteria 2362
167 nmdc:mga06r32_175115_c1 3300050510 Bacteria 2130
168 nmdc:mga08y16_11963_c1 3300050511 Bacteria 9113
169 nmdc:mga0n895_1238_c1 3300050512 Bacteria 18840
170 nmdc:mga0n895_124395_c1 3300050512 Bacteria 2602
171 nmdc:mga0n895_92193_c1 3300050512 Bacteria 3033
172 nmdc:mga0rr50_1988_c1 3300050513 Bacteria 11362
173 nmdc:mga0a205_6457_c1 3300050515 Bacteria 10600
174 nmdc:mga0a205_76253_c1 3300050515 Bacteria 3240
175 nmdc:mga0a205_914954_c1 3300050515 Bacteria 724
176 Ga0501084_0111070 3300054114 Bacteria 2304
177 Ga0501084_0593119 3300054114 Bacteria 936
178 Ga0501082_0151227 3300060353 Unclassified 2016
179 Ga0530510_0230549 3300061734 Unclassified 1377
180 2599102000 2597490356 Bacteria 7030811
181 2846957238 2846952575 Bacteria 6587527
182 2848863422 2848858292 Bacteria 7391279
183 Ga0068869_100474121
184 MBSR1b_contig_12936078
185 MBSR1b_contig_13410014
186 MBSR1b_contig_1836369
187 Ga0065715_10063162
188 Ga0070690_100180365
189 Ga0070680_100259384
190 Ga0070682_100271993
191 Ga0070689_101878556
192 Ga0070687_100637966
193 Ga0070703_10026957
194 Ga0070705_100213812
195 Ga0070705_100292838
196 Ga0070705_101610663
197 Ga0070708_100272150
198 Ga0070685_10334982
199 Ga0070706_101303190
200 Ga0070707_100016699
201 Ga0070707_100058832
202 Ga0070699_100494778
203 Ga0070672_101027170
204 Ga0070686_100230726
205 Ga0070686_100307832
206 Ga0070695_100053738
207 Ga0070695_100341404
208 Ga0070696_101527129
209 Ga0070704_100072514
210 Ga0068857_100366964
211 Ga0070702_100161610
212 Ga0070702_100812603
213 Ga0068864_100452783
214 Ga0068863_100274713
215 Ga0068858_100842091
216 Ga0068860_100837396
217 Ga0070717_11358108
218 Ga0075365_10000193
219 Ga0075365_10001394
220 Ga0075365_11237060
221 Ga0070712_100974357
222 Ga0075428_100013681
223 Ga0075428_100328200
224 Ga0075428_100336931
225 Ga0075430_101484834
226 Ga0075431_100329732
227 Ga0075433_10000579
228 Ga0075433_11030509
229 Ga0075434_100012271
230 Ga0075434_101123217
231 Ga0068865_101993422
232 Ga0075436_100020748
233 Ga0075435_100001223
234 Ga0075435_100456495
235 Ga0111539_10018763
236 Ga0105245_10012310
237 Ga0114129_10109761
238 Ga0114129_10175343
239 Ga0105242_11491463
240 Ga0105248_10174743
241 Ga0105248_10885409
242 Ga0105249_11194130
243 Ga0105249_13549958
244 Ga0105239_10240594
245 Ga0105246_10038047
246 Ga0105246_10331009
247 Ga0157378_10045995
248 Ga0157378_12039416
249 Ga0163162_10089419
250 Ga0157375_10036037
251 Ga0157375_10067488
252 Ga0163163_11346053
253 Ga0157380_10294240
254 Ga0157380_12666720
255 Ga0163161_10315029
256 Ga0206356_10552004
257 Ga0206356_11290606
258 Ga0224712_10325476
259 Ga0207653_10339021
260 Ga0207688_10041373
261 Ga0207643_10350912
262 Ga0207684_10197145
263 Ga0207660_11186199
264 Ga0207662_10551945
265 Ga0207646_10023341
266 Ga0207646_10066485
267 Ga0207659_10400297
268 Ga0207711_10449374
269 Ga0207679_11921066
270 Ga0207674_10422095
271 Ga0207675_100303430
272 Ga0207683_10750358
273 Ga0207428_10026897
274 Ga0268265_12311281
275 Ga0268264_11970965
276 Ga0265323_10047525
277 Ga0265327_10083906
278 Ga0307405_11611532
279 Ga0307413_11597726
280 Ga0307410_10487699
281 Ga0307410_10884196
282 Ga0307406_10155261
283 Ga0307406_10568992
284 Ga0307407_10237991
285 Ga0307409_101997894
286 Ga0307416_100374086
287 Ga0307416_101117957
288 Ga0307414_11632542
289 Ga0307411_11522497
290 Ga0307415_100553406
291 Ga0307415_100852805
292 Ga0373931_0098294
293 Ga0395905_1129560
294 Ga0395901_1117278
295 Ga0451577_0045091
296 Ga0453683_0167567
297 Ga0453684_0017962
298 Ga0453684_0038821
299 Ga0453684_1075900
300 Ga0451576_0960002
301 Ga0495668_0006308
302 Ga0495635_0591218
303 Ga0495680_0516682
304 Ga0496100_0008602
305 Ga0496101_1359728
306 Ga0496102_0009384
307 Ga0496103_0001813
308 Ga0496104_0117035
309 Ga0496105_0181113
310 Ga0496106_0168021
311 Ga0496107_1021226
312 Ga0496108_0031056
313 Ga0496109_0010430
314 Ga0496110_0092556
315 Ga0496111_0010333
316 Ga0496111_1130983
317 Ga0496112_0021829
318 Ga0496113_0006836
319 Ga0496114_0060598
320 Ga0496115_0008246
321 Ga0501031_0958632
322 Ga0501034_0254422
323 Ga0501036_0662559
324 Ga0501040_0617461
325 Ga0501042_0580655
326 Ga0501046_0007923
327 Ga0501071_0475077
328 Ga0501075_0115032
329 Ga0501075_0223630
330 Ga0501076_0020801
331 Ga0501225_0255799
332 Ga0501079_0551846
333 Ga0501079_1510742
334 Ga0501080_0209301
335 Ga0501081_0133763
336 Ga0501083_0509790
337 Ga0501044_0108975
338 Ga0501045_0173496
339 Ga0501045_0846596
340 nmdc:mga03n38_173297_c1
341 nmdc:mga0yw44_482483_c1
342 nmdc:mga05p37_10090_c1
343 nmdc:mga05p37_1186295_c1
344 nmdc:mga05p37_141213_c1
345 nmdc:mga0qj67_428892_c1
346 nmdc:mga0qj67_684227_c1
347 nmdc:mga06r32_1051191_c1
348 nmdc:mga06r32_143809_c1
349 nmdc:mga06r32_175115_c1
350 nmdc:mga08y16_11963_c1
351 nmdc:mga0n895_1238_c1
352 nmdc:mga0n895_124395_c1
353 nmdc:mga0n895_92193_c1
354 nmdc:mga0rr50_1988_c1
355 nmdc:mga0a205_6457_c1
356 nmdc:mga0a205_76253_c1
357 nmdc:mga0a205_914954_c1
358 Ga0501084_0111070
359 Ga0501084_0593119
360 Ga0501082_0151227
361 Ga0530510_0230549
362 2599102000
363 2846957238
364 2848863422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

39

139

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9749 2 141
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9687 1 140
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9676 1 140
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9659 1 140
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9614 2 141
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9619 1 140 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9615 2 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9547 2 141 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9358 1 140 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9293 5 141 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9971 46 141 GO:0004601
GO:0006979
AF-A0A7C5FTN1-F1-model_v4 OsmC family peroxiredoxin 0.9967 1 141 GO:0004601
GO:0006979
AF-A0A522GH03-F1-model_v4 OsmC family peroxiredoxin 0.9928 41 141 GO:0004601
GO:0006979
AF-A0A538NGU0-F1-model_v4 OsmC family peroxiredoxin 0.9907 1 100 GO:0004601
GO:0006979
AF-A0A2A2KGB6-F1-model_v4 Uncharacterized protein 0.9901 60 141 GO:0004601
GO:0006979

Map