F278201

General Info

Members Datasets Scaffolds Average Seq Length
181 120 362 90

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0001760|Ga0500559_0001760_5378_5698
Length 106
Sequence MARCDAERYLPPARMNPVTDHTAVSRFELIEDDKLAYADYVLTDGVLTIPHVEADPALRGTGAAGRLMDGIFTIARERDLKIRPICSYAVAYMLRRPETADLLAGG

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
72 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
103 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
104 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
105 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
106 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
107 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
108 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
116 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
117 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
118 2643221583 Caulobacter sp. Root655 Isolate Unclassified
119 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
120 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 0
Rhizoplane 0.55
Rhizosphere 79.01
Stem 0
Stem Tuber 0
Unclassified 17.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0001760 3300053136 Bacteria 11886
2 rootH2_10086778 3300003320 Bacteria 4142
3 rootH2_10111449 3300003320 Bacteria 5324
4 Ga0065704_10384781 3300005289 Bacteria 769
5 Ga0070670_100059167 3300005331 Bacteria 3289
6 Ga0070660_100230712 3300005339 Bacteria 1506
7 Ga0070691_10102174 3300005341 Bacteria 1425
8 Ga0070661_100000136 3300005344 Bacteria 61339
9 Ga0070668_100029791 3300005347 Bacteria 4147
10 Ga0070669_100058838 3300005353 Bacteria 2821
11 Ga0070667_100001697 3300005367 Bacteria 19690
12 Ga0070681_10251748 3300005458 Bacteria 1679
13 Ga0068867_101037684 3300005459 Bacteria 745
14 Ga0070679_100009509 3300005530 Bacteria 9194
15 Ga0070679_100202506 3300005530 Bacteria 1950
16 Ga0068853_101544287 3300005539 Unclassified 643
17 Ga0070696_101466637 3300005546 Bacteria 583
18 Ga0068855_100031332 3300005563 Bacteria 6350
19 Ga0068855_100181509 3300005563 Bacteria 2379
20 Ga0068857_102423904 3300005577 Bacteria 515
21 Ga0068854_100115590 3300005578 Bacteria 2030
22 Ga0068852_102642930 3300005616 Unclassified 521
23 Ga0068859_100003182 3300005617 Bacteria 16697
24 Ga0068864_100163421 3300005618 Bacteria 2025
25 Ga0068861_100035433 3300005719 Bacteria 3697
26 Ga0068863_100005600 3300005841 Bacteria 12343
27 Ga0068860_100069616 3300005843 Bacteria 3344
28 Ga0068862_100001777 3300005844 Bacteria 19494
29 Ga0075362_10416038 3300006177 Bacteria 679
30 Ga0097620_100003182 3300006931 Bacteria 16697
31 Ga0105240_10231772 3300009093 Bacteria 2146
32 Ga0105240_10712631 3300009093 Bacteria 1094
33 Ga0105240_10734833 3300009093 Bacteria 1074
34 Ga0105241_10328504 3300009174 Unclassified 1321
35 Ga0105248_10515129 3300009177 Bacteria 1349
36 Ga0157373_10109452 3300013100 Bacteria 1942
37 Ga0157370_10118065 3300013104 Bacteria 2478
38 Ga0157370_10245433 3300013104 Bacteria 1657
39 Ga0183365_10001 3300015684 Bacteria 2090444
40 Ga0213872_10016237 3300021361 Bacteria 3457
41 Ga0213875_10159459 3300021388 Bacteria 1058
42 Ga0207707_10082748 3300025912 Bacteria 2803
43 Ga0207695_10257262 3300025913 Bacteria 1644
44 Ga0207695_10497293 3300025913 Bacteria 1101
45 Ga0207695_10601752 3300025913 Bacteria 980
46 Ga0207660_10457814 3300025917 Unclassified 1032
47 Ga0207649_10000467 3300025920 Bacteria 28943
48 Ga0207652_10280957 3300025921 Bacteria 1502
49 Ga0207681_10075580 3300025923 Bacteria 2363
50 Ga0207650_10099648 3300025925 Bacteria 2234
51 Ga0207667_10152271 3300025949 Bacteria 2380
52 Ga0207668_10035575 3300025972 Bacteria 3317
53 Ga0207640_10090666 3300025981 Bacteria 2116
54 Ga0207640_11493992 3300025981 Unclassified 607
55 Ga0207658_10104314 3300025986 Bacteria 2227
56 Ga0207703_10120820 3300026035 Bacteria 2249
57 Ga0207702_11298630 3300026078 Unclassified 722
58 Ga0207641_10045041 3300026088 Bacteria 3713
59 Ga0207676_10200213 3300026095 Bacteria 1764
60 Ga0207698_12501890 3300026142 Unclassified 526
61 Ga0265325_10476570 3300031241 Unclassified 542
62 Ga0265331_10000054 3300031250 Bacteria 180181
63 Ga0265314_10078189 3300031711 Unclassified 2191
64 Ga0265314_10266229 3300031711 Unclassified 976
65 Ga0265314_10579630 3300031711 Bacteria 580
66 Ga0307516_10978463 3300031730 Bacteria 517
67 Ga0307413_10051077 3300031824 Bacteria 2489
68 Ga0307407_10045672 3300031903 Bacteria 2477
69 Ga0307409_100170798 3300031995 Bacteria 1913
70 Ga0307414_10023452 3300032004 Bacteria 3915
71 Ga0307411_10003457 3300032005 Bacteria 7335
72 Ga0395905_0255412 3300037471 Bacteria 1637
73 Ga0436364_0445902 3300037853 Bacteria 1227
74 Ga0436365_0908756 3300039437 Bacteria 2140
75 Ga0436360_0668379 3300039438 Bacteria 1268
76 Ga0436361_0015815 3300039447 Bacteria 15027
77 Ga0451789_0473265 3300041443 Bacteria 854
78 Ga0439445_0034923 3300042004 Bacteria 1319
79 Ga0450906_033662 3300042145 Bacteria 906
80 Ga0466963_1075905 3300044694 Unclassified 566
81 Ga0466963_1188720 3300044694 Bacteria 536
82 Ga0451576_0000276 3300045051 Bacteria 125948
83 Ga0451576_2042236 3300045051 Bacteria 590
84 Ga0495668_0498824 3300046616 Unclassified 671
85 Ga0496122_0021215 3300048925 Bacteria 5827
86 Ga0496125_0287303 3300048928 Bacteria 1015
87 Ga0501031_0025382 3300049568 Bacteria 3865
88 Ga0501032_0037965 3300049569 Bacteria 3282
89 Ga0501032_0041367 3300049569 Bacteria 3130
90 Ga0501033_0018441 3300049570 Bacteria 5273
91 Ga0501033_0210530 3300049570 Unclassified 1386
92 Ga0501034_0002685 3300049571 Bacteria 20966
93 Ga0501034_0152073 3300049571 Bacteria 2290
94 Ga0501034_0211988 3300049571 Bacteria 1892
95 Ga0501034_0297438 3300049571 Unclassified 1551
96 Ga0501034_1447324 3300049571 Bacteria 562
97 Ga0501036_0004895 3300049572 Bacteria 10818
98 Ga0501036_0047193 3300049572 Bacteria 3648
99 Ga0501036_0161925 3300049572 Bacteria 1886
100 Ga0501036_0883294 3300049572 Bacteria 734
101 Ga0501037_0001062 3300049573 Bacteria 20365
102 Ga0501037_0335967 3300049573 Bacteria 1044
103 Ga0501038_0015409 3300049574 Bacteria 6950
104 Ga0501038_0028626 3300049574 Bacteria 4949
105 Ga0501038_0116539 3300049574 Bacteria 2207
106 Ga0501039_0005536 3300049575 Bacteria 9559
107 Ga0501039_0217790 3300049575 Unclassified 1501
108 Ga0501042_0026620 3300049578 Bacteria 4063
109 Ga0501043_0059086 3300049579 Bacteria 3008
110 Ga0501043_0076320 3300049579 Bacteria 2633
111 Ga0501043_0171776 3300049579 Unclassified 1691
112 Ga0501046_0001896 3300049580 Bacteria 19883
113 Ga0501046_0073572 3300049580 Bacteria 2652
114 Ga0501046_0249685 3300049580 Bacteria 1306
115 Ga0501047_0021587 3300049581 Bacteria 6183
116 Ga0501047_0153728 3300049581 Bacteria 2175
117 Ga0501047_0644791 3300049581 Bacteria 879
118 Ga0501047_0928219 3300049581 Bacteria 684
119 Ga0501048_0014564 3300049582 Bacteria 5820
120 Ga0501067_0007829 3300049583 Bacteria 5941
121 Ga0501068_0031893 3300049584 Bacteria 3131
122 Ga0501069_0314235 3300049585 Unclassified 920
123 Ga0501069_0986359 3300049585 Unclassified 514
124 Ga0501070_0008309 3300049586 Bacteria 8771
125 Ga0501070_0145473 3300049586 Unclassified 1956
126 Ga0501070_0812957 3300049586 Unclassified 733
127 Ga0501070_0892307 3300049586 Bacteria 694
128 Ga0501071_0759694 3300049587 Unclassified 747
129 Ga0501073_0004735 3300049589 Bacteria 10215
130 Ga0501073_0011303 3300049589 Bacteria 6532
131 Ga0501074_0327285 3300049590 Unclassified 1088
132 Ga0501074_0959520 3300049590 Unclassified 601
133 Ga0501074_1321295 3300049590 Bacteria 505
134 Ga0501077_0478928 3300049593 Unclassified 798
135 Ga0501079_0007440 3300049741 Bacteria 8286
136 Ga0501080_0028804 3300049742 Bacteria 5170
137 Ga0501080_0114564 3300049742 Bacteria 2499
138 Ga0501080_1671709 3300049742 Bacteria 538
139 Ga0501035_0035679 3300049822 Bacteria 4512
140 Ga0501035_0142946 3300049822 Bacteria 2079
141 Ga0501035_0201890 3300049822 Bacteria 1704
142 Ga0501035_1056394 3300049822 Unclassified 636
143 Ga0501044_0032201 3300049823 Bacteria 5512
144 Ga0501044_0193917 3300049823 Bacteria 1992
145 Ga0501044_0255551 3300049823 Bacteria 1692
146 Ga0501044_0595714 3300049823 Bacteria 999
147 Ga0501044_0839509 3300049823 Bacteria 796
148 Ga0501044_0899378 3300049823 Bacteria 760
149 Ga0501044_1198058 3300049823 Unclassified 627
150 Ga0501044_1261725 3300049823 Bacteria 606
151 nmdc:mga03683_484960_c1 3300050489 Bacteria 597
152 nmdc:mga0k408_456561_c1 3300050493 Bacteria 758
153 Ga0500643_004522 3300053087 Bacteria 6251
154 Ga0500643_017194 3300053087 Bacteria 2428
155 Ga0500646_0064921 3300053090 Unclassified 1083
156 Ga0500646_0164010 3300053090 Bacteria 744
157 Ga0500641_0000443 3300053096 Bacteria 15003
158 Ga0500641_0001409 3300053096 Bacteria 8565
159 Ga0500556_0002009 3300053104 Bacteria 7127
160 Ga0500556_0005434 3300053104 Bacteria 3597
161 Ga0500562_003411 3300053108 Bacteria 3978
162 Ga0500562_010101 3300053108 Bacteria 2389
163 Ga0500593_131504 3300053117 Unclassified 998
164 Ga0500655_052584 3300053133 Unclassified 813
165 Ga0500604_0104932 3300053151 Bacteria 934
166 Ga0500616_0017285 3300053153 Bacteria 4095
167 Ga0500616_0054901 3300053153 Bacteria 2085
168 Ga0500622_0055797 3300053156 Bacteria 2023
169 Ga0500627_0171428 3300053158 Bacteria 978
170 Ga0500645_000131 3300053730 Bacteria 58717
171 Ga0500645_004614 3300053730 Bacteria 5246
172 Ga0500645_007852 3300053730 Bacteria 3688
173 Ga0501084_0012009 3300054114 Bacteria 7169
174 Ga0501082_0015707 3300060353 Bacteria 6513
175 Ga0501082_0436268 3300060353 Unclassified 1144
176 Ga0530510_1236443 3300061734 Unclassified 573
177 2512037839 2511231221 Bacteria 6846400
178 2523103043 2522572158 Bacteria 6514390
179 2643923611 2643221583 Bacteria 5218014
180 2897808315 2897803580 Bacteria 7000062
181 8054007017 8054002106 Bacteria 7987183
182 Ga0500559_0001760
183 rootH2_10086778
184 rootH2_10111449
185 Ga0065704_10384781
186 Ga0070670_100059167
187 Ga0070660_100230712
188 Ga0070691_10102174
189 Ga0070661_100000136
190 Ga0070668_100029791
191 Ga0070669_100058838
192 Ga0070667_100001697
193 Ga0070681_10251748
194 Ga0068867_101037684
195 Ga0070679_100009509
196 Ga0070679_100202506
197 Ga0068853_101544287
198 Ga0070696_101466637
199 Ga0068855_100031332
200 Ga0068855_100181509
201 Ga0068857_102423904
202 Ga0068854_100115590
203 Ga0068852_102642930
204 Ga0068859_100003182
205 Ga0068864_100163421
206 Ga0068861_100035433
207 Ga0068863_100005600
208 Ga0068860_100069616
209 Ga0068862_100001777
210 Ga0075362_10416038
211 Ga0097620_100003182
212 Ga0105240_10231772
213 Ga0105240_10712631
214 Ga0105240_10734833
215 Ga0105241_10328504
216 Ga0105248_10515129
217 Ga0157373_10109452
218 Ga0157370_10118065
219 Ga0157370_10245433
220 Ga0183365_10001
221 Ga0213872_10016237
222 Ga0213875_10159459
223 Ga0207707_10082748
224 Ga0207695_10257262
225 Ga0207695_10497293
226 Ga0207695_10601752
227 Ga0207660_10457814
228 Ga0207649_10000467
229 Ga0207652_10280957
230 Ga0207681_10075580
231 Ga0207650_10099648
232 Ga0207667_10152271
233 Ga0207668_10035575
234 Ga0207640_10090666
235 Ga0207640_11493992
236 Ga0207658_10104314
237 Ga0207703_10120820
238 Ga0207702_11298630
239 Ga0207641_10045041
240 Ga0207676_10200213
241 Ga0207698_12501890
242 Ga0265325_10476570
243 Ga0265331_10000054
244 Ga0265314_10078189
245 Ga0265314_10266229
246 Ga0265314_10579630
247 Ga0307516_10978463
248 Ga0307413_10051077
249 Ga0307407_10045672
250 Ga0307409_100170798
251 Ga0307414_10023452
252 Ga0307411_10003457
253 Ga0395905_0255412
254 Ga0436364_0445902
255 Ga0436365_0908756
256 Ga0436360_0668379
257 Ga0436361_0015815
258 Ga0451789_0473265
259 Ga0439445_0034923
260 Ga0450906_033662
261 Ga0466963_1075905
262 Ga0466963_1188720
263 Ga0451576_0000276
264 Ga0451576_2042236
265 Ga0495668_0498824
266 Ga0496122_0021215
267 Ga0496125_0287303
268 Ga0501031_0025382
269 Ga0501032_0037965
270 Ga0501032_0041367
271 Ga0501033_0018441
272 Ga0501033_0210530
273 Ga0501034_0002685
274 Ga0501034_0152073
275 Ga0501034_0211988
276 Ga0501034_0297438
277 Ga0501034_1447324
278 Ga0501036_0004895
279 Ga0501036_0047193
280 Ga0501036_0161925
281 Ga0501036_0883294
282 Ga0501037_0001062
283 Ga0501037_0335967
284 Ga0501038_0015409
285 Ga0501038_0028626
286 Ga0501038_0116539
287 Ga0501039_0005536
288 Ga0501039_0217790
289 Ga0501042_0026620
290 Ga0501043_0059086
291 Ga0501043_0076320
292 Ga0501043_0171776
293 Ga0501046_0001896
294 Ga0501046_0073572
295 Ga0501046_0249685
296 Ga0501047_0021587
297 Ga0501047_0153728
298 Ga0501047_0644791
299 Ga0501047_0928219
300 Ga0501048_0014564
301 Ga0501067_0007829
302 Ga0501068_0031893
303 Ga0501069_0314235
304 Ga0501069_0986359
305 Ga0501070_0008309
306 Ga0501070_0145473
307 Ga0501070_0812957
308 Ga0501070_0892307
309 Ga0501071_0759694
310 Ga0501073_0004735
311 Ga0501073_0011303
312 Ga0501074_0327285
313 Ga0501074_0959520
314 Ga0501074_1321295
315 Ga0501077_0478928
316 Ga0501079_0007440
317 Ga0501080_0028804
318 Ga0501080_0114564
319 Ga0501080_1671709
320 Ga0501035_0035679
321 Ga0501035_0142946
322 Ga0501035_0201890
323 Ga0501035_1056394
324 Ga0501044_0032201
325 Ga0501044_0193917
326 Ga0501044_0255551
327 Ga0501044_0595714
328 Ga0501044_0839509
329 Ga0501044_0899378
330 Ga0501044_1198058
331 Ga0501044_1261725
332 nmdc:mga03683_484960_c1
333 nmdc:mga0k408_456561_c1
334 Ga0500643_004522
335 Ga0500643_017194
336 Ga0500646_0064921
337 Ga0500646_0164010
338 Ga0500641_0000443
339 Ga0500641_0001409
340 Ga0500556_0002009
341 Ga0500556_0005434
342 Ga0500562_003411
343 Ga0500562_010101
344 Ga0500593_131504
345 Ga0500655_052584
346 Ga0500604_0104932
347 Ga0500616_0017285
348 Ga0500616_0054901
349 Ga0500622_0055797
350 Ga0500627_0171428
351 Ga0500645_000131
352 Ga0500645_004614
353 Ga0500645_007852
354 Ga0501084_0012009
355 Ga0501082_0015707
356 Ga0501082_0436268
357 Ga0530510_1236443
358 2512037839
359 2523103043
360 2643923611
361 2897808315
362 8054007017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14542

Acetyltransf_CG

GCN5-related N-acetyl-transferase

26

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8986 17 73
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8838 16 95
5xxs-assembly1.cif.gz_A crystal structure of native ribt from bacillus subtilis 0.878 17 75
2q4y-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex 0.8767 7 95
2q4y-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex 0.8499 7 95
ID Description Score Start End Superfamily
af_Q552L6_15_227_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9153 37 73 3.40.630.30
af_K7LQW1_676_805_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9014 17 75 3.40.630.30
2cntA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8946 17 73 3.40.630.30
af_D4A230_16_108_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.892 9 94 3.40.630.30
af_K7KT35_432_597_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8904 17 73 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0F2KQZ5-F1-model_v4 deleted 0.9949 17 95
AF-A0A525IPX6-F1-model_v4 N-acetyltransferase 0.9891 20 95 GO:0016740
AF-A0A1J4RJT1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9858 8 88
AF-A0A3D4KBK5-F1-model_v4 N-acetyltransferase 0.977 9 86 GO:0016740
AF-A0A525IPX6-F1-model_v4 N-acetyltransferase 0.9764 20 95 GO:0016740

Map