F278198

General Info

Members Datasets Scaffolds Average Seq Length
181 125 181 264

Family's Representative Sequence

Representative Sequence 3300053129|Ga0500628_001587|Ga0500628_001587_70_936
Length 288
Sequence MATRYEKGGEVLRRSRQAMIGTVKRAFKPSNRSLIRELVASDFKMRYQGSILGYLWSLLRPLLLFLVLYIVFTKVIPLGKDIPHYPAYLLLGIVVWTFFIEATTSGMNSITGRGDLIRKVNIPKYTIVIATTLSAFVNFSLNLTIVILFMIINGVAFRPEMIWAIPIIAEVVVLALGLSFLLAAMFVRFRDISHIWDVILQILFYAIPIIYPLTLPPQRIREIISLNPMTQILQDLRSVVITSDTLTPTEVFQSQFLGRVLPVLIVIAIAVIAGLYFRRRSRYFAEEL

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
108 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
109 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
114 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
115 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
116 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
119 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
120 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
121 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
122 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
123 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
124 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.18
Nodule 0
Rhizoplane 1.1
Rhizosphere 67.4
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002304 3300001915 Bacteria 5018
2 JGI24742J22300_10000009 3300002244 Bacteria 33403
3 rootH2_10000311 3300003320 Bacteria 277677
4 rootH2_10206827 3300003320 Bacteria 2272
5 rootL2_10298668 3300003322 Bacteria 2117
6 Ga0065704_10076811 3300005289 Bacteria 4969
7 Ga0070658_10000427 3300005327 Bacteria 36514
8 Ga0070658_10265106 3300005327 Bacteria 1460
9 Ga0070683_100001133 3300005329 Bacteria 20171
10 Ga0070690_100050091 3300005330 Bacteria 2664
11 Ga0070666_10006158 3300005335 Bacteria 7376
12 Ga0070666_10153467 3300005335 Bacteria 1607
13 Ga0070680_100001516 3300005336 Bacteria 16905
14 Ga0070680_100031961 3300005336 Unclassified 4233
15 Ga0070680_100585203 3300005336 Unclassified 958
16 Ga0070671_100000001 3300005355 Bacteria 1228151
17 Ga0070671_100011620 3300005355 Bacteria 7081
18 Ga0070671_100031027 3300005355 Bacteria 4413
19 Ga0070667_100001756 3300005367 Bacteria 19329
20 Ga0070678_100035414 3300005456 Bacteria 3485
21 Ga0070681_10002154 3300005458 Bacteria 17906
22 Ga0070699_100000054 3300005518 Bacteria 110997
23 Ga0070679_100096219 3300005530 Bacteria 2948
24 Ga0070679_100151241 3300005530 Bacteria 2297
25 Ga0070679_100697788 3300005530 Unclassified 958
26 Ga0070684_100000560 3300005535 Bacteria 25573
27 Ga0068853_100009747 3300005539 Bacteria 7748
28 Ga0068855_100005089 3300005563 Bacteria 16029
29 Ga0068855_100006892 3300005563 Bacteria 13785
30 Ga0068855_100007452 3300005563 Bacteria 13252
31 Ga0068855_100015469 3300005563 Bacteria 9185
32 Ga0068855_100045663 3300005563 Bacteria 5181
33 Ga0068854_100079840 3300005578 Unclassified 2413
34 Ga0068856_100000634 3300005614 Bacteria 38219
35 Ga0068856_100869947 3300005614 Bacteria 920
36 Ga0068852_100001110 3300005616 Bacteria 17750
37 Ga0075365_10265459 3300006038 Bacteria 1207
38 Ga0075368_10000434 3300006042 Bacteria 12351
39 Ga0075363_100000649 3300006048 Bacteria 11546
40 Ga0075364_10341608 3300006051 Bacteria 1020
41 Ga0075367_10001995 3300006178 Bacteria 9093
42 Ga0075369_10000017 3300006186 Bacteria 51611
43 Ga0075369_10000102 3300006186 Bacteria 22819
44 Ga0075369_10093807 3300006186 Unclassified 1341
45 Ga0075366_10000002 3300006195 Bacteria 153795
46 Ga0075366_10000382 3300006195 Bacteria 20515
47 Ga0075366_10101085 3300006195 Bacteria 1730
48 Ga0075370_10001350 3300006353 Bacteria 10564
49 Ga0068871_100178622 3300006358 Unclassified 1823
50 Ga0075428_100009960 3300006844 Bacteria 10560
51 Ga0105240_10005374 3300009093 Bacteria 19102
52 Ga0105240_10099463 3300009093 Bacteria 3540
53 Ga0105241_10289823 3300009174 Bacteria 1401
54 Ga0105241_10542819 3300009174 Bacteria 1043
55 Ga0105249_10140285 3300009553 Bacteria 2317
56 Ga0105033_100033 3300009986 Bacteria 10291
57 Ga0105239_10020794 3300010375 Bacteria 7241
58 Ga0157373_10000556 3300013100 Bacteria 29221
59 Ga0157370_10003736 3300013104 Bacteria 17800
60 Ga0157370_10116247 3300013104 Bacteria 2499
61 Ga0157370_10209327 3300013104 Bacteria 1808
62 Ga0157369_10000003 3300013105 Bacteria 507337
63 Ga0157374_10000056 3300013296 Bacteria 117163
64 Ga0157372_10671447 3300013307 Bacteria 1206
65 Ga0163163_10006019 3300014325 Bacteria 10553
66 Ga0157377_10092025 3300014745 Bacteria 1792
67 Ga0157376_10000001 3300014969 Bacteria 842910
68 Ga0207647_10158737 3300025904 Unclassified 1320
69 Ga0207705_10000057 3300025909 Bacteria 157369
70 Ga0207705_10211397 3300025909 Bacteria 1471
71 Ga0207707_10001736 3300025912 Bacteria 20033
72 Ga0207707_10391467 3300025912 Bacteria 1194
73 Ga0207695_10021051 3300025913 Bacteria 7449
74 Ga0207695_10087159 3300025913 Bacteria 3145
75 Ga0207695_10453143 3300025913 Bacteria 1166
76 Ga0207660_10000817 3300025917 Bacteria 20552
77 Ga0207660_10498507 3300025917 Unclassified 988
78 Ga0207652_10001821 3300025921 Bacteria 18474
79 Ga0207652_10015319 3300025921 Bacteria 6226
80 Ga0207652_10056169 3300025921 Bacteria 3389
81 Ga0207652_10222490 3300025921 Bacteria 1701
82 Ga0207652_10651300 3300025921 Unclassified 942
83 Ga0207644_10000001 3300025931 Bacteria 1243214
84 Ga0207644_10024027 3300025931 Unclassified 4180
85 Ga0207644_10105134 3300025931 Bacteria 2126
86 Ga0207661_10000412 3300025944 Bacteria 27614
87 Ga0207667_10003987 3300025949 Bacteria 18146
88 Ga0207667_10004604 3300025949 Bacteria 16915
89 Ga0207667_10033689 3300025949 Bacteria 5506
90 Ga0207667_10033951 3300025949 Bacteria 5481
91 Ga0207640_10021385 3300025981 Bacteria 3856
92 Ga0207658_10022065 3300025986 Bacteria 4428
93 Ga0207639_10014951 3300026041 Bacteria 5468
94 Ga0207702_10004069 3300026078 Bacteria 13124
95 Ga0207683_10018974 3300026121 Bacteria 5868
96 Ga0207698_10000816 3300026142 Bacteria 18121
97 Ga0209813_10000003 3300027866 Bacteria 207060
98 Ga0265337_1007524 3300028556 Bacteria 4068
99 Ga0265326_10000623 3300028558 Bacteria 13237
100 Ga0265326_10018855 3300028558 Bacteria 1984
101 Ga0265319_1029392 3300028563 Bacteria 1929
102 Ga0265319_1050764 3300028563 Unclassified 1369
103 Ga0265334_10000004 3300028573 Bacteria 243436
104 Ga0265338_10000003 3300028800 Bacteria 733923
105 Ga0265338_10002242 3300028800 Bacteria 29424
106 Ga0265338_10027199 3300028800 Bacteria 5744
107 Ga0316181_1224609 3300030744 Bacteria 3161
108 Ga0265320_10001750 3300031240 Bacteria 15384
109 Ga0265313_10016150 3300031595 Bacteria 4306
110 Ga0265314_10154290 3300031711 Bacteria 1404
111 Ga0307516_10000003 3300031730 Bacteria 459377
112 Ga0395899_0124374 3300037312 Unclassified 1845
113 Ga0395900_0001473 3300037418 Bacteria 28083
114 Ga0395900_0003106 3300037418 Bacteria 18033
115 Ga0395898_0016294 3300037466 Bacteria 7607
116 Ga0395898_0030293 3300037466 Bacteria 5416
117 Ga0395901_0032486 3300038443 Bacteria 5385
118 Ga0436360_0164644 3300039438 Bacteria 3351
119 Ga0436361_1033533 3300039447 Bacteria 8521
120 Ga0451802_0828359 3300041460 Unclassified 948
121 Ga0451576_0000055 3300045051 Bacteria 304830
122 Ga0495588_0001599 3300046674 Bacteria 9671
123 Ga0495649_0000025 3300046694 Bacteria 175449
124 Ga0495676_0245925 3300047321 Bacteria 1223
125 Ga0496112_0119277 3300048915 Bacteria 2608
126 Ga0496125_0346147 3300048928 Unclassified 890
127 Ga0496126_0049044 3300048929 Bacteria 3856
128 Ga0501032_0000553 3300049569 Bacteria 30300
129 Ga0501034_0006461 3300049571 Bacteria 12625
130 Ga0501037_0000137 3300049573 Bacteria 68308
131 Ga0501038_0011766 3300049574 Bacteria 7984
132 Ga0501042_0179490 3300049578 Bacteria 1527
133 Ga0501046_0000085 3300049580 Bacteria 100298
134 Ga0501047_0000252 3300049581 Bacteria 63507
135 Ga0501048_0000001 3300049582 Bacteria 132132
136 Ga0501069_0047420 3300049585 Unclassified 2385
137 Ga0501070_0014001 3300049586 Bacteria 6752
138 Ga0501073_0021816 3300049589 Bacteria 4613
139 Ga0501083_0027054 3300049744 Bacteria 3960
140 Ga0501276_000065 3300049773 Bacteria 5454
141 Ga0501035_0000975 3300049822 Bacteria 30259
142 Ga0501035_0028752 3300049822 Bacteria 5072
143 nmdc:mga03n38_58_c1 3300050490 Bacteria 23178
144 nmdc:mga00v17_420725_c1 3300050491 Bacteria 868
145 nmdc:mga0yw44_238827_c1 3300050492 Bacteria 1207
146 nmdc:mga0k408_187861_c1 3300050493 Bacteria 1232
147 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
148 nmdc:mga0k408_264_c1 3300050493 Bacteria 28733
149 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
150 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
151 nmdc:mga07m45_316024_c1 3300050496 Unclassified 908
152 nmdc:mga07m45_939_c1 3300050496 Bacteria 12756
153 nmdc:mga0sz30_12_c1 3300050516 Bacteria 96867
154 nmdc:mga0sz30_16748_c1 3300050516 Bacteria 2916
155 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
156 nmdc:mga0sz30_89097_c1 3300050516 Unclassified 1341
157 Ga0500610_0000011 3300053079 Bacteria 91172
158 Ga0500610_0004762 3300053079 Bacteria 5449
159 Ga0500643_000009 3300053087 Bacteria 444150
160 Ga0500643_001536 3300053087 Bacteria 13105
161 Ga0500644_0000052 3300053088 Bacteria 69890
162 Ga0500644_0001479 3300053088 Bacteria 6180
163 Ga0500646_0004362 3300053090 Unclassified 3580
164 Ga0500646_0004665 3300053090 Bacteria 3466
165 Ga0500583_0000353 3300053092 Bacteria 15110
166 Ga0500651_0000011 3300053093 Bacteria 246573
167 Ga0500555_000001 3300053103 Bacteria 1353713
168 Ga0500555_000002 3300053103 Bacteria 1314346
169 Ga0500556_0028840 3300053104 Bacteria 1866
170 Ga0500594_0002413 3300053118 Unclassified 4070
171 Ga0500614_000001 3300053123 Bacteria 1274484
172 Ga0500628_000018 3300053129 Bacteria 85560
173 Ga0500628_001587 3300053129 Bacteria 3868
174 Ga0500642_0001038 3300053130 Bacteria 8002
175 Ga0500652_000009 3300053131 Bacteria 163737
176 Ga0500577_0000439 3300053142 Bacteria 10706
177 Ga0500589_000003 3300053147 Bacteria 220717
178 Ga0500589_063585 3300053147 Bacteria 1686
179 Ga0500649_000003 3300053722 Bacteria 140482
180 Ga0500611_000634 3300053727 Bacteria 3574
181 Ga0501082_0007276 3300060353 Bacteria 9549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0001599 Ga0495588_0001599_6840_7502 215
2 3300047321 Ga0495676_0245925 Ga0495676_0245925_408_1070 215
3 3300053123 Ga0500614_000001 Ga0500614_000001_870051_870713 215
4 3300053722 Ga0500649_000003 Ga0500649_000003_35400_36062 215
5 3300053079 Ga0500610_0004762 Ga0500610_0004762_2291_2953 220
6 3300053092 Ga0500583_0000353 Ga0500583_0000353_12323_12985 220
7 3300006038 Ga0075365_10265459 Ga0075365_102654592 232
8 3300045051 Ga0451576_0000055 Ga0451576_0000055_6051_6842 232
9 3300050492 nmdc:mga0yw44_238827_c1 nmdc:mga0yw44_238827_c1_103_918 232
10 3300050516 nmdc:mga0sz30_16748_c1 nmdc:mga0sz30_16748_c1_502_1317 232
11 3300050491 nmdc:mga00v17_420725_c1 nmdc:mga00v17_420725_c1_150_851 233
12 3300030744 Ga0316181_1224609 Ga0316181_12246094 236
13 3300039447 Ga0436361_1033533 Ga0436361_1033533_6752_7618 236
14 3300005289 Ga0065704_10076811 Ga0065704_100768114 247
15 3300006042 Ga0075368_10000434 Ga0075368_1000043410 248
16 3300006048 Ga0075363_100000649 Ga0075363_1000006499 248
17 3300006178 Ga0075367_10001995 Ga0075367_100019956 248
18 3300027866 Ga0209813_10000003 Ga0209813_1000000386 248
19 3300050490 nmdc:mga03n38_58_c1 nmdc:mga03n38_58_c1_4552_5364 248
20 3300050494 nmdc:mga06z11_2_c1 nmdc:mga06z11_2_c1_90749_91561 248
21 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_128769_129581 248
22 3300053090 Ga0500646_0004665 Ga0500646_0004665_39_830 248
23 3300006353 Ga0075370_10001350 Ga0075370_100013505 249
24 3300050496 nmdc:mga07m45_939_c1 nmdc:mga07m45_939_c1_5818_6630 249
25 3300053142 Ga0500577_0000439 Ga0500577_0000439_8759_9577 250
26 3300005355 Ga0070671_100031027 Ga0070671_1000310272 253
27 3300005518 Ga0070699_100000054 Ga0070699_10000005438 253
28 3300025931 Ga0207644_10105134 Ga0207644_101051342 253
29 3300006186 Ga0075369_10000017 Ga0075369_1000001723 254
30 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_242789_243601 254
31 3300005367 Ga0070667_100001756 Ga0070667_1000017565 255
32 3300005456 Ga0070678_100035414 Ga0070678_1000354143 255
33 3300006358 Ga0068871_100178622 Ga0068871_1001786222 255
34 3300025986 Ga0207658_10022065 Ga0207658_100220653 255
35 3300026121 Ga0207683_10018974 Ga0207683_100189744 255
36 3300053130 Ga0500642_0001038 Ga0500642_0001038_2056_2868 255
37 3300053147 Ga0500589_000003 Ga0500589_000003_163611_164423 255
38 3300006186 Ga0075369_10000102 Ga0075369_1000010216 256
39 3300006195 Ga0075366_10000002 Ga0075366_10000002144 256
40 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_174387_175157 256
41 3300050496 nmdc:mga07m45_316024_c1 nmdc:mga07m45_316024_c1_68_838 256
42 3300050516 nmdc:mga0sz30_12_c1 nmdc:mga0sz30_12_c1_62347_63117 256
43 3300028556 Ga0265337_1007524 Ga0265337_10075242 263
44 3300028800 Ga0265338_10002242 Ga0265338_100022423 263
45 3300031240 Ga0265320_10001750 Ga0265320_100017503 263
46 3300031711 Ga0265314_10154290 Ga0265314_101542902 263
47 3300028558 Ga0265326_10018855 Ga0265326_100188552 264
48 3300028563 Ga0265319_1029392 Ga0265319_10293922 264
49 3300005335 Ga0070666_10153467 Ga0070666_101534672 265
50 3300005355 Ga0070671_100000001 Ga0070671_1000000011127 265
51 3300025904 Ga0207647_10158737 Ga0207647_101587372 265
52 3300025931 Ga0207644_10000001 Ga0207644_10000001310 265
53 3300037418 Ga0395900_0001473 Ga0395900_0001473_21189_21995 265
54 3300037466 Ga0395898_0030293 Ga0395898_0030293_3112_3918 265
55 3300002244 JGI24742J22300_10000009 JGI24742J22300_1000000913 266
56 3300003322 rootL2_10298668 rootL2_102986681 266
57 3300005330 Ga0070690_100050091 Ga0070690_1000500911 266
58 3300005335 Ga0070666_10006158 Ga0070666_100061582 266
59 3300005336 Ga0070680_100585203 Ga0070680_1005852031 266
60 3300005530 Ga0070679_100697788 Ga0070679_1006977881 266
61 3300005539 Ga0068853_100009747 Ga0068853_1000097476 266
62 3300005563 Ga0068855_100005089 Ga0068855_1000050892 266
63 3300005563 Ga0068855_100007452 Ga0068855_1000074522 266
64 3300005563 Ga0068855_100015469 Ga0068855_1000154696 266
65 3300005563 Ga0068855_100045663 Ga0068855_1000456635 266
66 3300005578 Ga0068854_100079840 Ga0068854_1000798403 266
67 3300005614 Ga0068856_100869947 Ga0068856_1008699471 266
68 3300005616 Ga0068852_100001110 Ga0068852_1000011103 266
69 3300009093 Ga0105240_10099463 Ga0105240_100994633 266
70 3300013104 Ga0157370_10003736 Ga0157370_1000373615 266
71 3300013104 Ga0157370_10116247 Ga0157370_101162472 266
72 3300013105 Ga0157369_10000003 Ga0157369_10000003156 266
73 3300014325 Ga0163163_10006019 Ga0163163_100060192 266
74 3300025913 Ga0207695_10087159 Ga0207695_100871593 266
75 3300025917 Ga0207660_10498507 Ga0207660_104985071 266
76 3300025921 Ga0207652_10056169 Ga0207652_100561693 266
77 3300025921 Ga0207652_10651300 Ga0207652_106513001 266
78 3300025949 Ga0207667_10004604 Ga0207667_1000460417 266
79 3300025949 Ga0207667_10033689 Ga0207667_100336893 266
80 3300025949 Ga0207667_10033951 Ga0207667_100339512 266
81 3300025981 Ga0207640_10021385 Ga0207640_100213853 266
82 3300026041 Ga0207639_10014951 Ga0207639_100149514 266
83 3300026142 Ga0207698_10000816 Ga0207698_1000081615 266
84 3300028558 Ga0265326_10000623 Ga0265326_100006232 266
85 3300028563 Ga0265319_1050764 Ga0265319_10507641 266
86 3300028573 Ga0265334_10000004 Ga0265334_1000000474 266
87 3300028800 Ga0265338_10000003 Ga0265338_1000000345 266
88 3300031595 Ga0265313_10016150 Ga0265313_100161503 266
89 3300039438 Ga0436360_0164644 Ga0436360_0164644_205_1017 266
90 3300048928 Ga0496125_0346147 Ga0496125_0346147_55_855 266
91 3300049569 Ga0501032_0000553 Ga0501032_0000553_25837_26643 266
92 3300049571 Ga0501034_0006461 Ga0501034_0006461_10096_10902 266
93 3300049573 Ga0501037_0000137 Ga0501037_0000137_58011_58817 266
94 3300049574 Ga0501038_0011766 Ga0501038_0011766_12_818 266
95 3300049578 Ga0501042_0179490 Ga0501042_0179490_483_1289 266
96 3300049580 Ga0501046_0000085 Ga0501046_0000085_60498_61304 266
97 3300049581 Ga0501047_0000252 Ga0501047_0000252_35564_36370 266
98 3300049582 Ga0501048_0000001 Ga0501048_0000001_122128_122934 266
99 3300049585 Ga0501069_0047420 Ga0501069_0047420_1503_2309 266
100 3300049586 Ga0501070_0014001 Ga0501070_0014001_2717_3523 266
101 3300049589 Ga0501073_0021816 Ga0501073_0021816_2856_3662 266
102 3300049744 Ga0501083_0027054 Ga0501083_0027054_1417_2223 266
103 3300049822 Ga0501035_0000975 Ga0501035_0000975_24510_25316 266
104 3300049822 Ga0501035_0028752 Ga0501035_0028752_1016_1816 266
105 3300053087 Ga0500643_000009 Ga0500643_000009_270208_271032 266
106 3300053147 Ga0500589_063585 Ga0500589_063585_822_1628 266
107 3300053727 Ga0500611_000634 Ga0500611_000634_2750_3556 266
108 3300060353 Ga0501082_0007276 Ga0501082_0007276_258_1064 266
109 3300003320 rootH2_10000311 rootH2_10000311160 267
110 3300005327 Ga0070658_10000427 Ga0070658_1000042727 267
111 3300005530 Ga0070679_100096219 Ga0070679_1000962191 267
112 3300005530 Ga0070679_100151241 Ga0070679_1001512412 267
113 3300006051 Ga0075364_10341608 Ga0075364_103416081 267
114 3300006195 Ga0075366_10000382 Ga0075366_100003828 267
115 3300009174 Ga0105241_10542819 Ga0105241_105428192 267
116 3300025909 Ga0207705_10000057 Ga0207705_10000057100 267
117 3300025912 Ga0207707_10391467 Ga0207707_103914671 267
118 3300025921 Ga0207652_10222490 Ga0207652_102224902 267
119 3300037312 Ga0395899_0124374 Ga0395899_0124374_800_1603 267
120 3300037418 Ga0395900_0003106 Ga0395900_0003106_11384_12187 267
121 3300037466 Ga0395898_0016294 Ga0395898_0016294_1932_2735 267
122 3300038443 Ga0395901_0032486 Ga0395901_0032486_1588_2391 267
123 3300041460 Ga0451802_0828359 Ga0451802_0828359_50_865 267
124 3300050493 nmdc:mga0k408_264_c1 nmdc:mga0k408_264_c1_15896_16714 267
125 3300053079 Ga0500610_0000011 Ga0500610_0000011_79875_80687 267
126 3300053087 Ga0500643_001536 Ga0500643_001536_3625_4437 267
127 3300053088 Ga0500644_0000052 Ga0500644_0000052_60760_61572 267
128 3300053088 Ga0500644_0001479 Ga0500644_0001479_1029_1844 267
129 3300053103 Ga0500555_000001 Ga0500555_000001_170903_171721 267
130 3300053103 Ga0500555_000002 Ga0500555_000002_1125428_1126240 267
131 3300053118 Ga0500594_0002413 Ga0500594_0002413_1206_2021 267
132 3300053129 Ga0500628_000018 Ga0500628_000018_18319_19134 267
133 3300053129 Ga0500628_001587 Ga0500628_001587_70_936 267
134 3300053131 Ga0500652_000009 Ga0500652_000009_16328_17140 267
135 3300003320 rootH2_10206827 rootH2_102068272 268
136 3300005327 Ga0070658_10265106 Ga0070658_102651062 268
137 3300005336 Ga0070680_100001516 Ga0070680_1000015161 268
138 3300005336 Ga0070680_100031961 Ga0070680_1000319614 268
139 3300005355 Ga0070671_100011620 Ga0070671_1000116204 268
140 3300005458 Ga0070681_10002154 Ga0070681_100021542 268
141 3300005563 Ga0068855_100006892 Ga0068855_1000068922 268
142 3300006186 Ga0075369_10093807 Ga0075369_100938072 268
143 3300006195 Ga0075366_10101085 Ga0075366_101010852 268
144 3300006844 Ga0075428_100009960 Ga0075428_1000099609 268
145 3300009553 Ga0105249_10140285 Ga0105249_101402851 268
146 3300009986 Ga0105033_100033 Ga0105033_1000337 268
147 3300010375 Ga0105239_10020794 Ga0105239_100207944 268
148 3300013296 Ga0157374_10000056 Ga0157374_1000005666 268
149 3300013307 Ga0157372_10671447 Ga0157372_106714472 268
150 3300014745 Ga0157377_10092025 Ga0157377_100920252 268
151 3300014969 Ga0157376_10000001 Ga0157376_10000001721 268
152 3300025909 Ga0207705_10211397 Ga0207705_102113972 268
153 3300025912 Ga0207707_10001736 Ga0207707_100017364 268
154 3300025913 Ga0207695_10453143 Ga0207695_104531431 268
155 3300025917 Ga0207660_10000817 Ga0207660_100008174 268
156 3300025921 Ga0207652_10001821 Ga0207652_1000182116 268
157 3300025921 Ga0207652_10015319 Ga0207652_100153194 268
158 3300025931 Ga0207644_10024027 Ga0207644_100240272 268
159 3300025949 Ga0207667_10003987 Ga0207667_1000398716 268
160 3300028800 Ga0265338_10027199 Ga0265338_100271993 268
161 3300031730 Ga0307516_10000003 Ga0307516_1000000359 268
162 3300046694 Ga0495649_0000025 Ga0495649_0000025_65728_66534 268
163 3300048915 Ga0496112_0119277 Ga0496112_0119277_768_1595 268
164 3300048929 Ga0496126_0049044 Ga0496126_0049044_2770_3576 268
165 3300049773 Ga0501276_000065 Ga0501276_000065_199_1005 268
166 3300050493 nmdc:mga0k408_187861_c1 nmdc:mga0k408_187861_c1_280_1086 268
167 3300050516 nmdc:mga0sz30_89097_c1 nmdc:mga0sz30_89097_c1_66_878 268
168 3300053090 Ga0500646_0004362 Ga0500646_0004362_1710_2522 268
169 3300053093 Ga0500651_0000011 Ga0500651_0000011_163148_163957 268
170 3300053104 Ga0500556_0028840 Ga0500556_0028840_471_1277 268
171 3300001915 JGI24741J21665_1002304 JGI24741J21665_10023044 270
172 3300005329 Ga0070683_100001133 Ga0070683_10000113316 270
173 3300005535 Ga0070684_100000560 Ga0070684_10000056019 270
174 3300005614 Ga0068856_100000634 Ga0068856_10000063420 270
175 3300009093 Ga0105240_10005374 Ga0105240_100053747 270
176 3300009174 Ga0105241_10289823 Ga0105241_102898232 270
177 3300013100 Ga0157373_10000556 Ga0157373_100005566 270
178 3300013104 Ga0157370_10209327 Ga0157370_102093272 270
179 3300025913 Ga0207695_10021051 Ga0207695_100210514 270
180 3300025944 Ga0207661_10000412 Ga0207661_100004124 270
181 3300026078 Ga0207702_10004069 Ga0207702_100040694 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

33

241

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8801 11 270
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8768 11 270
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8692 11 266
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8609 11 270
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8545 11 270
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.674 65 258 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6146 65 256 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5098 65 258 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4615 65 256 3.40.1710.10
af_Q9Y7Y4_92_240_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.4151 43 191 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A7L4WF67-F1-model_v4 Transport permease protein 0.9675 10 270 GO:0005886
GO:0015920
GO:0016740
GO:0140359
AF-A0A0G0Z9B0-F1-model_v4 Transport permease protein 0.9613 9 270 GO:0015920
GO:0043190
GO:0140359
AF-A0A7W0RCB5-F1-model_v4 Transport permease protein 0.9606 9 270 GO:0015920
GO:0043190
GO:0140359
AF-A0A1G1W1Z7-F1-model_v4 Transport permease protein 0.9591 13 270 GO:0015920
GO:0043190
GO:0140359
AF-A0A4Y7X7G4-F1-model_v4 deleted 0.9588 15 222

Feature Viewer

pLDDT pTM Quality
86.62 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map