F278163

General Info

Members Datasets Scaffolds Average Seq Length
181 95 332 129

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_24936_c1|nmdc:mga0qj67_24936_c1_1779_2213
Length 144
Sequence MPTKIQQQRNGEIVMPALNRVQLIGRLGKDPEGKFTPTGKKVVHFSMAISNRWKSKEGETKEYTEWVNIEAWGRLGEVCQEYLKKGSLVFLEGRLKTDRYDDNGETRYFSKVVALAMQMLDRKPNDEPMLTVEEESSEYEVEPA

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
78 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
85 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 35.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_24936_c1 3300050509 Bacteria 4615
2 JGI25406J46586_10008820 3300003203 Bacteria 4542
3 JGI25406J46586_10092240 3300003203 Bacteria 912
4 Ga0058863_10003207 3300004799 Unclassified 949
5 Ga0065704_10423859 3300005289 Unclassified 729
6 Ga0065704_10467792 3300005289 Unclassified 692
7 Ga0065707_10048418 3300005295 Bacteria 1036
8 Ga0065707_10084741 3300005295 Bacteria 6830
9 Ga0065707_10287056 3300005295 Unclassified 1034
10 Ga0065707_10298412 3300005295 Bacteria 1009
11 Ga0065707_10309907 3300005295 Bacteria 977
12 Ga0065707_10472628 3300005295 Bacteria 781
13 Ga0070680_100609199 3300005336 Bacteria 937
14 Ga0070688_101410810 3300005365 Unclassified 565
15 Ga0070705_101238682 3300005440 Bacteria 616
16 Ga0070700_100541434 3300005441 Bacteria 903
17 Ga0070694_100097033 3300005444 Unclassified 2079
18 Ga0070694_100098670 3300005444 Unclassified 2063
19 Ga0070694_100595139 3300005444 Bacteria 890
20 Ga0070706_100022196 3300005467 Bacteria 5844
21 Ga0070706_101139998 3300005467 Unclassified 717
22 Ga0070698_100011297 3300005471 Bacteria 9480
23 Ga0070698_100109532 3300005471 Unclassified 2728
24 Ga0070698_100116427 3300005471 Unclassified 2636
25 Ga0070698_101164838 3300005471 Bacteria 720
26 Ga0070699_100270095 3300005518 Unclassified 1522
27 Ga0070697_100956417 3300005536 Bacteria 761
28 Ga0070695_100093484 3300005545 Bacteria 2012
29 Ga0070695_100356771 3300005545 Unclassified 1097
30 Ga0070695_100918739 3300005545 Bacteria 708
31 Ga0070696_100234849 3300005546 Unclassified 1381
32 Ga0070696_100352718 3300005546 Unclassified 1140
33 Ga0070704_101158450 3300005549 Bacteria 704
34 Ga0068857_100180555 3300005577 Bacteria 1921
35 Ga0070702_100518701 3300005615 Unclassified 878
36 Ga0068859_100376579 3300005617 Bacteria 1515
37 Ga0068861_100715715 3300005719 Bacteria 932
38 Ga0081539_10000656 3300005985 Bacteria 69569
39 Ga0081539_10138430 3300005985 Bacteria 1186
40 Ga0075427_10000428 3300006194 Bacteria 4787
41 Ga0075428_100725930 3300006844 Unclassified 1058
42 Ga0075428_101049583 3300006844 Unclassified 862
43 Ga0075428_101337474 3300006844 Unclassified 753
44 Ga0075428_101401536 3300006844 Unclassified 733
45 Ga0075430_100032889 3300006846 Bacteria 4402
46 Ga0075430_101432059 3300006846 Unclassified 568
47 Ga0075431_100092673 3300006847 Bacteria 3118
48 Ga0075431_100356924 3300006847 Bacteria 1469
49 Ga0075429_100240892 3300006880 Bacteria 1584
50 Ga0075429_100576852 3300006880 Bacteria 986
51 Ga0075429_100593377 3300006880 Unclassified 971
52 Ga0075429_101442823 3300006880 Unclassified 599
53 Ga0097620_100376583 3300006931 Bacteria 1515
54 Ga0105240_11004626 3300009093 Bacteria 892
55 Ga0111539_13100569 3300009094 Unclassified 536
56 Ga0114129_10024488 3300009147 Bacteria 8553
57 Ga0114129_10236924 3300009147 Bacteria 2455
58 Ga0105243_10049235 3300009148 Unclassified 3323
59 Ga0105243_10709326 3300009148 Bacteria 982
60 Ga0105242_10031027 3300009176 Unclassified 4267
61 Ga0207684_10025571 3300025910 Bacteria 5031
62 Ga0207660_11048200 3300025917 Bacteria 665
63 Ga0207686_10077848 3300025934 Unclassified 2154
64 Ga0207709_10029294 3300025935 Unclassified 3191
65 Ga0207674_10495762 3300026116 Unclassified 1180
66 Ga0207675_102106258 3300026118 Bacteria 580
67 Ga0268265_10859222 3300028380 Bacteria 888
68 Ga0265318_10121675 3300028577 Bacteria 960
69 Ga0265323_10208704 3300028653 Unclassified 614
70 Ga0265328_10198380 3300031239 Bacteria 762
71 Ga0265320_10087029 3300031240 Bacteria 1452
72 Ga0265329_10125229 3300031242 Unclassified 826
73 Ga0265340_10041789 3300031247 Unclassified 2253
74 Ga0265316_10316821 3300031344 Unclassified 1134
75 Ga0316575_10045157 3300031665 Unclassified 1749
76 Ga0265342_10238320 3300031712 Unclassified 975
77 Ga0316577_10026992 3300031733 Bacteria 3200
78 Ga0307413_11486377 3300031824 Unclassified 598
79 Ga0307410_10119256 3300031852 Bacteria 1921
80 Ga0307407_10504544 3300031903 Bacteria 887
81 Ga0307412_10041259 3300031911 Bacteria 2990
82 Ga0307409_100206567 3300031995 Bacteria 1762
83 Ga0307416_102963202 3300032002 Unclassified 568
84 Ga0307415_100056238 3300032126 Unclassified 2696
85 Ga0316583_10034640 3300032133 Unclassified 1792
86 Ga0316585_10211399 3300032137 Bacteria 641
87 Ga0316586_1054117 3300033527 Bacteria 721
88 Ga0316582_0912108 3300036647 Unclassified 601
89 Ga0316582_1207874 3300036647 Unclassified 515
90 Ga0316584_0023955 3300036712 Bacteria 4463
91 Ga0451800_0743189 3300041459 Unclassified 979
92 Ga0451853_2838007 3300041512 Bacteria 1785
93 Ga0451577_0011088 3300042876 Bacteria 8555
94 Ga0451577_0060617 3300042876 Bacteria 3373
95 Ga0451577_0196655 3300042876 Bacteria 1820
96 Ga0451577_0469964 3300042876 Bacteria 1142
97 Ga0451577_1192669 3300042876 Bacteria 679
98 Ga0451577_1691395 3300042876 Unclassified 557
99 Ga0453683_0016912 3300044673 Bacteria 4702
100 Ga0453683_0279945 3300044673 Unclassified 1065
101 Ga0453683_0350691 3300044673 Bacteria 948
102 Ga0453683_0387161 3300044673 Bacteria 900
103 Ga0453683_0700965 3300044673 Unclassified 663
104 Ga0453684_0000012 3300044712 Bacteria 1062512
105 Ga0453684_0000232 3300044712 Bacteria 240951
106 Ga0453684_0000269 3300044712 Bacteria 223826
107 Ga0453684_0001229 3300044712 Bacteria 78474
108 Ga0453684_0011993 3300044712 Bacteria 14416
109 Ga0453684_0043660 3300044712 Bacteria 6021
110 Ga0453684_0054805 3300044712 Bacteria 5189
111 Ga0453684_0098013 3300044712 Unclassified 3596
112 Ga0453684_0293890 3300044712 Bacteria 1849
113 Ga0453684_0348513 3300044712 Unclassified 1670
114 Ga0453684_0376332 3300044712 Unclassified 1595
115 Ga0453684_0380810 3300044712 Bacteria 1584
116 Ga0453684_0408558 3300044712 Bacteria 1519
117 Ga0453684_0578320 3300044712 Bacteria 1234
118 Ga0453684_0620678 3300044712 Bacteria 1183
119 Ga0453684_0732471 3300044712 Bacteria 1072
120 Ga0453684_1088163 3300044712 Unclassified 845
121 Ga0453684_1204832 3300044712 Bacteria 795
122 Ga0453684_1629350 3300044712 Bacteria 661
123 Ga0453684_2193746 3300044712 Unclassified 552
124 Ga0451576_0006333 3300045051 Bacteria 14544
125 Ga0451576_0010495 3300045051 Bacteria 10618
126 Ga0451576_0024575 3300045051 Bacteria 6506
127 Ga0451576_0050541 3300045051 Bacteria 4359
128 Ga0451576_0260733 3300045051 Bacteria 1812
129 Ga0501298_055939 3300049521 Bacteria 827
130 Ga0501036_0327517 3300049572 Bacteria 1280
131 Ga0501037_0654468 3300049573 Bacteria 702
132 Ga0501040_0473589 3300049576 Bacteria 902
133 Ga0501041_0056316 3300049577 Unclassified 2402
134 Ga0501046_0232628 3300049580 Bacteria 1361
135 Ga0501048_0119640 3300049582 Unclassified 1861
136 Ga0501071_0077635 3300049587 Unclassified 2426
137 Ga0501072_0055004 3300049588 Bacteria 3137
138 Ga0501073_0220265 3300049589 Unclassified 1311
139 Ga0501074_0038535 3300049590 Bacteria 3464
140 Ga0501074_0685953 3300049590 Bacteria 723
141 Ga0501075_0012524 3300049591 Bacteria 6031
142 Ga0501075_0350839 3300049591 Bacteria 1124
143 Ga0501076_0965435 3300049592 Bacteria 702
144 Ga0501076_0988142 3300049592 Unclassified 693
145 Ga0501079_0020611 3300049741 Bacteria 5041
146 Ga0501079_0299665 3300049741 Bacteria 1258
147 Ga0501080_0144751 3300049742 Bacteria 2197
148 Ga0501081_0544008 3300049743 Bacteria 867
149 Ga0501266_072304 3300049763 Unclassified 571
150 Ga0501045_0389282 3300049824 Bacteria 1037
151 Ga0501045_0971469 3300049824 Unclassified 623
152 nmdc:mga05p37_415609_c1 3300050507 Bacteria 1567
153 nmdc:mga05p37_5894_c1 3300050507 Bacteria 14413
154 nmdc:mga09592_189603_c1 3300050508 Bacteria 1780
155 nmdc:mga09592_265272_c1 3300050508 Unclassified 1489
156 nmdc:mga09592_373221_c1 3300050508 Bacteria 1234
157 nmdc:mga09592_611634_c1 3300050508 Bacteria 933
158 nmdc:mga06r32_94765_c1 3300050510 Unclassified 2921
159 nmdc:mga08y16_318622_c1 3300050511 Bacteria 1601
160 nmdc:mga0n895_466123_c1 3300050512 Bacteria 1275
161 nmdc:mga0a205_5071_c1 3300050515 Bacteria 11844
162 Ga0501084_0096034 3300054114 Bacteria 2489
163 Ga0501084_0256752 3300054114 Bacteria 1475
164 Ga0501082_0051822 3300060353 Bacteria 3537
165 Ga0530510_0100537 3300061734 Bacteria 2114
166 Ga0530510_0163828 3300061734 Bacteria 1645
167 nmdc:mga0qj67_24936_c1
168 JGI25406J46586_10008820
169 JGI25406J46586_10092240
170 Ga0058863_10003207
171 Ga0065704_10423859
172 Ga0065704_10467792
173 Ga0065707_10048418
174 Ga0065707_10084741
175 Ga0065707_10287056
176 Ga0065707_10298412
177 Ga0065707_10309907
178 Ga0065707_10472628
179 Ga0070680_100609199
180 Ga0070688_101410810
181 Ga0070705_101238682
182 Ga0070700_100541434
183 Ga0070694_100097033
184 Ga0070694_100098670
185 Ga0070694_100595139
186 Ga0070706_100022196
187 Ga0070706_101139998
188 Ga0070698_100011297
189 Ga0070698_100109532
190 Ga0070698_100116427
191 Ga0070698_101164838
192 Ga0070699_100270095
193 Ga0070697_100956417
194 Ga0070695_100093484
195 Ga0070695_100356771
196 Ga0070695_100918739
197 Ga0070696_100234849
198 Ga0070696_100352718
199 Ga0070704_101158450
200 Ga0068857_100180555
201 Ga0070702_100518701
202 Ga0068859_100376579
203 Ga0068861_100715715
204 Ga0081539_10000656
205 Ga0081539_10138430
206 Ga0075427_10000428
207 Ga0075428_100725930
208 Ga0075428_101049583
209 Ga0075428_101337474
210 Ga0075428_101401536
211 Ga0075430_100032889
212 Ga0075430_101432059
213 Ga0075431_100092673
214 Ga0075431_100356924
215 Ga0075429_100240892
216 Ga0075429_100576852
217 Ga0075429_100593377
218 Ga0075429_101442823
219 Ga0097620_100376583
220 Ga0105240_11004626
221 Ga0111539_13100569
222 Ga0114129_10024488
223 Ga0114129_10236924
224 Ga0105243_10049235
225 Ga0105243_10709326
226 Ga0105242_10031027
227 Ga0207684_10025571
228 Ga0207660_11048200
229 Ga0207686_10077848
230 Ga0207709_10029294
231 Ga0207674_10495762
232 Ga0207675_102106258
233 Ga0268265_10859222
234 Ga0265318_10121675
235 Ga0265323_10208704
236 Ga0265328_10198380
237 Ga0265320_10087029
238 Ga0265329_10125229
239 Ga0265340_10041789
240 Ga0265316_10316821
241 Ga0316575_10045157
242 Ga0265342_10238320
243 Ga0316577_10026992
244 Ga0307413_11486377
245 Ga0307410_10119256
246 Ga0307407_10504544
247 Ga0307412_10041259
248 Ga0307409_100206567
249 Ga0307416_102963202
250 Ga0307415_100056238
251 Ga0316583_10034640
252 Ga0316585_10211399
253 Ga0316586_1054117
254 Ga0316582_0912108
255 Ga0316582_1207874
256 Ga0316584_0023955
257 Ga0451800_0743189
258 Ga0451853_2838007
259 Ga0451577_0011088
260 Ga0451577_0060617
261 Ga0451577_0196655
262 Ga0451577_0469964
263 Ga0451577_1192669
264 Ga0451577_1691395
265 Ga0453683_0016912
266 Ga0453683_0279945
267 Ga0453683_0350691
268 Ga0453683_0387161
269 Ga0453683_0700965
270 Ga0453684_0000012
271 Ga0453684_0000232
272 Ga0453684_0000269
273 Ga0453684_0001229
274 Ga0453684_0011993
275 Ga0453684_0043660
276 Ga0453684_0054805
277 Ga0453684_0098013
278 Ga0453684_0293890
279 Ga0453684_0348513
280 Ga0453684_0376332
281 Ga0453684_0380810
282 Ga0453684_0408558
283 Ga0453684_0578320
284 Ga0453684_0620678
285 Ga0453684_0732471
286 Ga0453684_1088163
287 Ga0453684_1204832
288 Ga0453684_1629350
289 Ga0453684_2193746
290 Ga0451576_0006333
291 Ga0451576_0010495
292 Ga0451576_0024575
293 Ga0451576_0050541
294 Ga0451576_0260733
295 Ga0501298_055939
296 Ga0501036_0327517
297 Ga0501037_0654468
298 Ga0501040_0473589
299 Ga0501041_0056316
300 Ga0501046_0232628
301 Ga0501048_0119640
302 Ga0501071_0077635
303 Ga0501072_0055004
304 Ga0501073_0220265
305 Ga0501074_0038535
306 Ga0501074_0685953
307 Ga0501075_0012524
308 Ga0501075_0350839
309 Ga0501076_0965435
310 Ga0501076_0988142
311 Ga0501079_0020611
312 Ga0501079_0299665
313 Ga0501080_0144751
314 Ga0501081_0544008
315 Ga0501266_072304
316 Ga0501045_0389282
317 Ga0501045_0971469
318 nmdc:mga05p37_415609_c1
319 nmdc:mga05p37_5894_c1
320 nmdc:mga09592_189603_c1
321 nmdc:mga09592_265272_c1
322 nmdc:mga09592_373221_c1
323 nmdc:mga09592_611634_c1
324 nmdc:mga06r32_94765_c1
325 nmdc:mga08y16_318622_c1
326 nmdc:mga0n895_466123_c1
327 nmdc:mga0a205_5071_c1
328 Ga0501084_0096034
329 Ga0501084_0256752
330 Ga0501082_0051822
331 Ga0530510_0100537
332 Ga0530510_0163828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

18

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqy-assembly1.cif.gz_C structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii 0.9475 5 105
2vw9-assembly1.cif.gz_B-2 single stranded dna binding protein complex from helicobacter pylori 0.9437 5 104
5odn-assembly1.cif.gz_E salinibacter ruber single-strand binding protein 0.9301 5 105
7f2n-assembly1.cif.gz_A crystal structure of ssb from klebsiella pneumonia. 0.9231 1 104
3udg-assembly2.cif.gz_B structure of deinococcus radiodurans ssb bound to ssdna 0.9216 6 106
ID Description Score Start End Superfamily
2vw9B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9348 5 105 2.40.50.140
1x3eB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.907 5 106 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9063 1 104 2.40.50.140
3udgB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9027 2 106 2.40.50.140
3ulpC00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8999 1 105 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1G9IA47-F1-model_v4 Single-stranded DNA-binding protein 0.9652 5 103 GO:0003697
GO:0006260
GO:0009295
AF-A0A0F9MDI7-F1-model_v4 Single-stranded DNA-binding protein 0.9583 5 106 GO:0003697
GO:0006260
GO:0009295
AF-A0A496JV80-F1-model_v4 deleted 0.957 4 104
AF-A0A1S8CQW5-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9539 5 107 GO:0003697
GO:0006260
GO:0009295
AF-A0A4Q2Y7D3-F1-model_v4 Single-stranded DNA-binding protein 0.9517 1 106 GO:0003697
GO:0006260
GO:0009295

Map