F278123

General Info

Members Datasets Scaffolds Average Seq Length
181 108 179 195

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0106526|Ga0501070_0106526_1574_2248
Length 224
Sequence MATNKIIKQKKMQSNTIDTHSSSGKTGQQKILIFDNYDSFTYNLVHLVEMIIQDKVDVFRNDKIALEDVECYDKIILSPGPGLPCEAGLLLPLIERYAASKPILGVCLGHQAIGEVFGGQLTNLTTVFHGVATPVHLKQVSSTKKYSQLFEGLPETFEAGRYHSWVVDKENFPADLEITAEDDNGFIMALQHKTYNIQGVQFHPESVLTPAGEKIMRNWLVQKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
102 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
103 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1994362 2162886007 Bacteria 2992
2 Ga0065704_10072255 3300005289 Bacteria 8855
3 Ga0070658_10057776 3300005327 Bacteria 3156
4 Ga0070658_10227391 3300005327 Bacteria 1579
5 Ga0070683_100212940 3300005329 Bacteria 1836
6 Ga0070670_100039428 3300005331 Bacteria 4062
7 Ga0068869_100028450 3300005334 Bacteria 3906
8 Ga0070680_100002139 3300005336 Bacteria 14605
9 Ga0070680_100122815 3300005336 Unclassified 2168
10 Ga0070680_100887201 3300005336 Bacteria 769
11 Ga0070682_100001275 3300005337 Bacteria 14290
12 Ga0070660_100000800 3300005339 Bacteria 20862
13 Ga0070660_100029405 3300005339 Bacteria 4118
14 Ga0070660_100106276 3300005339 Bacteria 2229
15 Ga0070689_100419008 3300005340 Bacteria 1134
16 Ga0070691_10004326 3300005341 Bacteria 6456
17 Ga0070668_100026058 3300005347 Bacteria 4434
18 Ga0070659_100007938 3300005366 Bacteria 7732
19 Ga0070681_10021777 3300005458 Bacteria 6428
20 Ga0070681_10102679 3300005458 Unclassified 2804
21 Ga0070681_10557666 3300005458 Bacteria 1059
22 Ga0070679_100004536 3300005530 Bacteria 12825
23 Ga0070679_100042885 3300005530 Bacteria 4506
24 Ga0070679_100043938 3300005530 Bacteria 4450
25 Ga0070679_101031235 3300005530 Bacteria 767
26 Ga0068853_100159796 3300005539 Bacteria 2033
27 Ga0068853_100366192 3300005539 Bacteria 1344
28 Ga0070693_100071026 3300005547 Bacteria 2050
29 Ga0070693_100494636 3300005547 Unclassified 866
30 Ga0068855_100022883 3300005563 Bacteria 7490
31 Ga0068855_100042513 3300005563 Bacteria 5384
32 Ga0068855_100064567 3300005563 Bacteria 4270
33 Ga0068857_100153289 3300005577 Bacteria 2089
34 Ga0068856_100811138 3300005614 Bacteria 955
35 Ga0068852_100142742 3300005616 Bacteria 2218
36 Ga0068859_100067422 3300005617 Bacteria 3613
37 Ga0068864_100026175 3300005618 Bacteria 4918
38 Ga0068851_10587798 3300005834 Bacteria 676
39 Ga0068858_101688771 3300005842 Bacteria 625
40 Ga0068860_100121868 3300005843 Bacteria 2497
41 Ga0068862_100003779 3300005844 Bacteria 12914
42 Ga0097620_100067425 3300006931 Bacteria 3613
43 Ga0105240_10001595 3300009093 Bacteria 38516
44 Ga0105241_10000881 3300009174 Bacteria 22671
45 Ga0105241_10230030 3300009174 Bacteria 1562
46 Ga0105237_10266431 3300009545 Bacteria 1716
47 Ga0157373_10028385 3300013100 Bacteria 4036
48 Ga0157373_10030973 3300013100 Bacteria 3849
49 Ga0157373_10144633 3300013100 Bacteria 1672
50 Ga0157373_10427300 3300013100 Bacteria 952
51 Ga0157371_10001340 3300013102 Bacteria 25920
52 Ga0157371_10003654 3300013102 Bacteria 13849
53 Ga0157371_10008389 3300013102 Bacteria 8237
54 Ga0157371_10032895 3300013102 Bacteria 3729
55 Ga0157371_10034773 3300013102 Bacteria 3613
56 Ga0157371_10053609 3300013102 Bacteria 2864
57 Ga0157371_10456222 3300013102 Bacteria 940
58 Ga0157371_10765995 3300013102 Bacteria 726
59 Ga0157370_10002692 3300013104 Bacteria 21301
60 Ga0157370_10006823 3300013104 Bacteria 12514
61 Ga0157370_10407859 3300013104 Bacteria 1250
62 Ga0157370_10506899 3300013104 Unclassified 1108
63 Ga0157369_10026016 3300013105 Bacteria 6493
64 Ga0157369_10046667 3300013105 Bacteria 4708
65 Ga0157369_10047784 3300013105 Bacteria 4645
66 Ga0157374_10973192 3300013296 Bacteria 867
67 Ga0157372_10005934 3300013307 Bacteria 12984
68 Ga0157372_10015725 3300013307 Bacteria 8115
69 Ga0157372_10050754 3300013307 Bacteria 4614
70 Ga0157372_10061677 3300013307 Bacteria 4199
71 Ga0157372_10214259 3300013307 Bacteria 2232
72 Ga0157372_10752851 3300013307 Bacteria 1133
73 Ga0157376_10163776 3300014969 Bacteria 2018
74 Ga0182006_1010187 3300015261 Bacteria 4189
75 Ga0207656_10197439 3300025321 Bacteria 971
76 Ga0207705_10214684 3300025909 Bacteria 1460
77 Ga0207654_10005580 3300025911 Bacteria 6363
78 Ga0207707_10000051 3300025912 Bacteria 117204
79 Ga0207695_10158800 3300025913 Bacteria 2194
80 Ga0207660_10005186 3300025917 Bacteria 8471
81 Ga0207660_10029654 3300025917 Bacteria 3756
82 Ga0207657_10024041 3300025919 Bacteria 5657
83 Ga0207657_10037574 3300025919 Bacteria 4321
84 Ga0207657_10245480 3300025919 Bacteria 1428
85 Ga0207657_10830800 3300025919 Bacteria 713
86 Ga0207652_10000384 3300025921 Bacteria 46082
87 Ga0207652_10039453 3300025921 Bacteria 4007
88 Ga0207681_10239015 3300025923 Bacteria 1413
89 Ga0207706_10218313 3300025933 Bacteria 1670
90 Ga0207689_10069790 3300025942 Bacteria 2887
91 Ga0207667_10015451 3300025949 Bacteria 8671
92 Ga0207667_10086364 3300025949 Bacteria 3246
93 Ga0207667_10643300 3300025949 Bacteria 1066
94 Ga0207640_10187400 3300025981 Bacteria 1557
95 Ga0207639_10061775 3300026041 Bacteria 2895
96 Ga0207639_10241425 3300026041 Bacteria 1571
97 Ga0207639_10254076 3300026041 Bacteria 1534
98 Ga0207702_10623489 3300026078 Bacteria 1059
99 Ga0207641_10475078 3300026088 Bacteria 1211
100 Ga0207676_10034551 3300026095 Bacteria 3829
101 Ga0207674_10065141 3300026116 Bacteria 3674
102 Ga0207674_10167317 3300026116 Bacteria 2152
103 Ga0207698_10282900 3300026142 Unclassified 1535
104 Ga0207698_10793508 3300026142 Bacteria 949
105 Ga0268265_10945793 3300028380 Bacteria 848
106 Ga0268264_10015087 3300028381 Bacteria 6337
107 Ga0268264_10807036 3300028381 Bacteria 938
108 Ga0265323_10000082 3300028653 Bacteria 54153
109 Ga0307515_10009265 3300028794 Bacteria 19056
110 Ga0265327_10000395 3300031251 Bacteria 81944
111 Ga0265327_10066390 3300031251 Bacteria 1821
112 Ga0265316_10000982 3300031344 Bacteria 30963
113 Ga0316579_10099846 3300031691 Bacteria 1389
114 Ga0265342_10077052 3300031712 Bacteria 1932
115 Ga0265342_10207004 3300031712 Bacteria 1063
116 Ga0316576_10140004 3300031727 Bacteria 1822
117 Ga0316576_10251145 3300031727 Bacteria 1328
118 Ga0316576_10432913 3300031727 Bacteria 973
119 Ga0307405_10000001 3300031731 Bacteria 1731270
120 Ga0316577_10021865 3300031733 Bacteria 3550
121 Ga0307406_10145769 3300031901 Bacteria 1682
122 Ga0307414_10058952 3300032004 Bacteria 2708
123 Ga0307414_10193204 3300032004 Bacteria 1649
124 Ga0373923_0180510 3300035111 Bacteria 970
125 Ga0316574_0649145 3300035398 Bacteria 650
126 Ga0316584_0003091 3300036712 Bacteria 10734
127 Ga0316584_0763846 3300036712 Bacteria 659
128 Ga0395899_0040931 3300037312 Unclassified 3464
129 Ga0395899_0217848 3300037312 Unclassified 1323
130 Ga0395900_0025707 3300037418 Bacteria 6027
131 Ga0395900_0488090 3300037418 Unclassified 1183
132 Ga0395898_0063471 3300037466 Unclassified 3584
133 Ga0395898_0161006 3300037466 Bacteria 2146
134 Ga0395898_0375114 3300037466 Unclassified 1356
135 Ga0395905_0131875 3300037471 Bacteria 2350
136 Ga0395905_0180636 3300037471 Bacteria 1981
137 Ga0395901_0001630 3300038443 Bacteria 23212
138 Ga0395901_0297516 3300038443 Bacteria 1673
139 Ga0436365_0320654 3300039437 Bacteria 1406
140 Ga0451577_0000515 3300042876 Bacteria 64793
141 Ga0453683_0525040 3300044673 Bacteria 769
142 Ga0453684_0015367 3300044712 Bacteria 12121
143 Ga0453684_0375257 3300044712 Unclassified 1598
144 Ga0453684_1028632 3300044712 Bacteria 874
145 Ga0453684_1225609 3300044712 Unclassified 786
146 Ga0495585_0209368 3300046492 Bacteria 989
147 Ga0495633_0182899 3300046558 Bacteria 965
148 Ga0496115_0192487 3300048918 Bacteria 1685
149 Ga0496121_0211393 3300048924 Bacteria 1374
150 Ga0501031_0061294 3300049568 Bacteria 2451
151 Ga0501032_0008028 3300049569 Bacteria 7695
152 Ga0501032_0331047 3300049569 Bacteria 982
153 Ga0501032_0442135 3300049569 Bacteria 833
154 Ga0501033_0000384 3300049570 Bacteria 42525
155 Ga0501034_0000172 3300049571 Bacteria 120544
156 Ga0501034_0119096 3300049571 Bacteria 2627
157 Ga0501034_0122716 3300049571 Bacteria 2584
158 Ga0501036_0017194 3300049572 Bacteria 6045
159 Ga0501037_0054976 3300049573 Bacteria 2911
160 Ga0501037_0062981 3300049573 Bacteria 2704
161 Ga0501038_0046606 3300049574 Bacteria 3758
162 Ga0501039_0003374 3300049575 Bacteria 11938
163 Ga0501043_0186150 3300049579 Bacteria 1616
164 Ga0501043_0531461 3300049579 Bacteria 876
165 Ga0501043_0565591 3300049579 Bacteria 843
166 Ga0501047_0129980 3300049581 Bacteria 2399
167 Ga0501048_0054125 3300049582 Bacteria 2851
168 Ga0501070_0086328 3300049586 Unclassified 2598
169 Ga0501070_0106526 3300049586 Bacteria 2317
170 Ga0501217_064263 3300049661 Bacteria 987
171 Ga0501217_121969 3300049661 Bacteria 757
172 Ga0501224_010782 3300049664 Bacteria 1341
173 Ga0501257_056244 3300049686 Bacteria 988
174 Ga0501080_0275105 3300049742 Bacteria 1532
175 Ga0501035_0037391 3300049822 Bacteria 4396
176 Ga0501044_0055688 3300049823 Bacteria 4060
177 Ga0501044_0284142 3300049823 Bacteria 1587
178 Ga0501044_0324297 3300049823 Bacteria 1464
179 Ga0501045_0021285 3300049824 Bacteria 4638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100142742 Ga0068852_1001427423 170
2 3300049661 Ga0501217_064263 Ga0501217_064263_325_891 178
3 3300049661 Ga0501217_121969 Ga0501217_121969_43_609 178
4 3300049664 Ga0501224_010782 Ga0501224_010782_364_930 178
5 3300049686 Ga0501257_056244 Ga0501257_056244_158_724 178
6 3300036712 Ga0316584_0763846 Ga0316584_0763846_23_592 181
7 iso_pu_bacteria 2890804823 2890808099 181
8 iso_pu_bacteria 8036736890 8036738447 183
9 3300013307 Ga0157372_10005934 Ga0157372_100059343 186
10 3300026041 Ga0207639_10241425 Ga0207639_102414252 186
11 3300028381 Ga0268264_10807036 Ga0268264_108070362 186
12 3300049568 Ga0501031_0061294 Ga0501031_0061294_1361_1927 186
13 3300049569 Ga0501032_0008028 Ga0501032_0008028_1752_2318 186
14 3300049570 Ga0501033_0000384 Ga0501033_0000384_35971_36582 186
15 3300049571 Ga0501034_0000172 Ga0501034_0000172_117996_118562 186
16 3300049571 Ga0501034_0119096 Ga0501034_0119096_1912_2508 186
17 3300049572 Ga0501036_0017194 Ga0501036_0017194_4377_4988 186
18 3300049573 Ga0501037_0054976 Ga0501037_0054976_386_952 186
19 3300049574 Ga0501038_0046606 Ga0501038_0046606_1915_2526 186
20 3300049575 Ga0501039_0003374 Ga0501039_0003374_7710_8321 186
21 3300049579 Ga0501043_0186150 Ga0501043_0186150_14_580 186
22 3300049582 Ga0501048_0054125 Ga0501048_0054125_215_781 186
23 3300049822 Ga0501035_0037391 Ga0501035_0037391_2285_2896 186
24 3300049823 Ga0501044_0055688 Ga0501044_0055688_2261_2872 186
25 3300049824 Ga0501045_0021285 Ga0501045_0021285_1664_2230 186
26 3300005336 Ga0070680_100887201 Ga0070680_1008872012 187
27 3300005547 Ga0070693_100494636 Ga0070693_1004946361 187
28 3300013100 Ga0157373_10028385 Ga0157373_100283853 187
29 3300013102 Ga0157371_10003654 Ga0157371_1000365412 187
30 3300013102 Ga0157371_10053609 Ga0157371_100536092 187
31 3300013105 Ga0157369_10046667 Ga0157369_100466672 187
32 3300013105 Ga0157369_10047784 Ga0157369_100477845 187
33 3300013307 Ga0157372_10050754 Ga0157372_100507542 187
34 3300031251 Ga0265327_10066390 Ga0265327_100663903 187
35 3300032004 Ga0307414_10058952 Ga0307414_100589522 187
36 3300032004 Ga0307414_10193204 Ga0307414_101932042 187
37 3300037466 Ga0395898_0161006 Ga0395898_0161006_706_1284 187
38 3300037471 Ga0395905_0131875 Ga0395905_0131875_299_877 187
39 3300039437 Ga0436365_0320654 Ga0436365_0320654_209_775 187
40 3300042876 Ga0451577_0000515 Ga0451577_0000515_42602_43210 187
41 3300044712 Ga0453684_0375257 Ga0453684_0375257_34_600 187
42 3300044712 Ga0453684_1028632 Ga0453684_1028632_85_693 187
43 3300044712 Ga0453684_1225609 Ga0453684_1225609_189_758 187
44 2162886007 SwRhRL2b_contig_1994362 SwRhRL2b_0791.00006170 188
45 3300005289 Ga0065704_10072255 Ga0065704_100722554 188
46 3300005327 Ga0070658_10057776 Ga0070658_100577763 188
47 3300005327 Ga0070658_10227391 Ga0070658_102273912 188
48 3300005329 Ga0070683_100212940 Ga0070683_1002129402 188
49 3300005331 Ga0070670_100039428 Ga0070670_1000394282 188
50 3300005334 Ga0068869_100028450 Ga0068869_1000284505 188
51 3300005336 Ga0070680_100002139 Ga0070680_10000213914 188
52 3300005336 Ga0070680_100122815 Ga0070680_1001228152 188
53 3300005337 Ga0070682_100001275 Ga0070682_1000012755 188
54 3300005339 Ga0070660_100000800 Ga0070660_1000008004 188
55 3300005339 Ga0070660_100029405 Ga0070660_1000294053 188
56 3300005339 Ga0070660_100106276 Ga0070660_1001062761 188
57 3300005340 Ga0070689_100419008 Ga0070689_1004190081 188
58 3300005341 Ga0070691_10004326 Ga0070691_100043261 188
59 3300005347 Ga0070668_100026058 Ga0070668_1000260583 188
60 3300005366 Ga0070659_100007938 Ga0070659_1000079382 188
61 3300005458 Ga0070681_10021777 Ga0070681_100217776 188
62 3300005458 Ga0070681_10102679 Ga0070681_101026793 188
63 3300005458 Ga0070681_10557666 Ga0070681_105576662 188
64 3300005530 Ga0070679_100004536 Ga0070679_1000045368 188
65 3300005530 Ga0070679_100042885 Ga0070679_1000428853 188
66 3300005530 Ga0070679_100043938 Ga0070679_1000439385 188
67 3300005530 Ga0070679_101031235 Ga0070679_1010312351 188
68 3300005539 Ga0068853_100159796 Ga0068853_1001597963 188
69 3300005539 Ga0068853_100366192 Ga0068853_1003661921 188
70 3300005547 Ga0070693_100071026 Ga0070693_1000710261 188
71 3300005563 Ga0068855_100022883 Ga0068855_1000228834 188
72 3300005563 Ga0068855_100042513 Ga0068855_1000425133 188
73 3300005563 Ga0068855_100064567 Ga0068855_1000645674 188
74 3300005577 Ga0068857_100153289 Ga0068857_1001532892 188
75 3300005614 Ga0068856_100811138 Ga0068856_1008111381 188
76 3300005617 Ga0068859_100067422 Ga0068859_1000674225 188
77 3300005618 Ga0068864_100026175 Ga0068864_1000261751 188
78 3300005834 Ga0068851_10587798 Ga0068851_105877981 188
79 3300005842 Ga0068858_101688771 Ga0068858_1016887711 188
80 3300005843 Ga0068860_100121868 Ga0068860_1001218682 188
81 3300005844 Ga0068862_100003779 Ga0068862_1000037796 188
82 3300006931 Ga0097620_100067425 Ga0097620_1000674255 188
83 3300009093 Ga0105240_10001595 Ga0105240_100015957 188
84 3300009174 Ga0105241_10000881 Ga0105241_100008816 188
85 3300009174 Ga0105241_10230030 Ga0105241_102300302 188
86 3300009545 Ga0105237_10266431 Ga0105237_102664312 188
87 3300013100 Ga0157373_10030973 Ga0157373_100309735 188
88 3300013100 Ga0157373_10144633 Ga0157373_101446332 188
89 3300013100 Ga0157373_10427300 Ga0157373_104273002 188
90 3300013102 Ga0157371_10001340 Ga0157371_1000134014 188
91 3300013102 Ga0157371_10008389 Ga0157371_100083898 188
92 3300013102 Ga0157371_10032895 Ga0157371_100328953 188
93 3300013102 Ga0157371_10034773 Ga0157371_100347733 188
94 3300013102 Ga0157371_10456222 Ga0157371_104562222 188
95 3300013102 Ga0157371_10765995 Ga0157371_107659951 188
96 3300013104 Ga0157370_10002692 Ga0157370_1000269223 188
97 3300013104 Ga0157370_10006823 Ga0157370_100068232 188
98 3300013104 Ga0157370_10407859 Ga0157370_104078592 188
99 3300013104 Ga0157370_10506899 Ga0157370_105068991 188
100 3300013105 Ga0157369_10026016 Ga0157369_100260165 188
101 3300013296 Ga0157374_10973192 Ga0157374_109731921 188
102 3300013307 Ga0157372_10015725 Ga0157372_100157258 188
103 3300013307 Ga0157372_10061677 Ga0157372_100616775 188
104 3300013307 Ga0157372_10214259 Ga0157372_102142592 188
105 3300013307 Ga0157372_10752851 Ga0157372_107528512 188
106 3300014969 Ga0157376_10163776 Ga0157376_101637762 188
107 3300015261 Ga0182006_1010187 Ga0182006_10101872 188
108 3300025321 Ga0207656_10197439 Ga0207656_101974392 188
109 3300025909 Ga0207705_10214684 Ga0207705_102146842 188
110 3300025911 Ga0207654_10005580 Ga0207654_100055806 188
111 3300025912 Ga0207707_10000051 Ga0207707_1000005154 188
112 3300025913 Ga0207695_10158800 Ga0207695_101588002 188
113 3300025917 Ga0207660_10005186 Ga0207660_100051862 188
114 3300025917 Ga0207660_10029654 Ga0207660_100296541 188
115 3300025919 Ga0207657_10024041 Ga0207657_100240414 188
116 3300025919 Ga0207657_10037574 Ga0207657_100375742 188
117 3300025919 Ga0207657_10245480 Ga0207657_102454802 188
118 3300025919 Ga0207657_10830800 Ga0207657_108308001 188
119 3300025921 Ga0207652_10000384 Ga0207652_1000038429 188
120 3300025921 Ga0207652_10039453 Ga0207652_100394533 188
121 3300025923 Ga0207681_10239015 Ga0207681_102390152 188
122 3300025933 Ga0207706_10218313 Ga0207706_102183132 188
123 3300025942 Ga0207689_10069790 Ga0207689_100697902 188
124 3300025949 Ga0207667_10015451 Ga0207667_100154512 188
125 3300025949 Ga0207667_10086364 Ga0207667_100863643 188
126 3300025949 Ga0207667_10643300 Ga0207667_106433002 188
127 3300025981 Ga0207640_10187400 Ga0207640_101874003 188
128 3300026041 Ga0207639_10061775 Ga0207639_100617752 188
129 3300026041 Ga0207639_10254076 Ga0207639_102540762 188
130 3300026078 Ga0207702_10623489 Ga0207702_106234892 188
131 3300026088 Ga0207641_10475078 Ga0207641_104750782 188
132 3300026095 Ga0207676_10034551 Ga0207676_100345516 188
133 3300026116 Ga0207674_10065141 Ga0207674_100651412 188
134 3300026116 Ga0207674_10167317 Ga0207674_101673173 188
135 3300026142 Ga0207698_10282900 Ga0207698_102829001 188
136 3300026142 Ga0207698_10793508 Ga0207698_107935081 188
137 3300028380 Ga0268265_10945793 Ga0268265_109457932 188
138 3300028381 Ga0268264_10015087 Ga0268264_100150878 188
139 3300028653 Ga0265323_10000082 Ga0265323_1000008242 188
140 3300028794 Ga0307515_10009265 Ga0307515_1000926520 188
141 3300031251 Ga0265327_10000395 Ga0265327_1000039550 188
142 3300031344 Ga0265316_10000982 Ga0265316_1000098217 188
143 3300031691 Ga0316579_10099846 Ga0316579_100998462 188
144 3300031712 Ga0265342_10077052 Ga0265342_100770522 188
145 3300031712 Ga0265342_10207004 Ga0265342_102070042 188
146 3300031727 Ga0316576_10140004 Ga0316576_101400041 188
147 3300031727 Ga0316576_10251145 Ga0316576_102511452 188
148 3300031727 Ga0316576_10432913 Ga0316576_104329132 188
149 3300031731 Ga0307405_10000001 Ga0307405_100000011570 188
150 3300031733 Ga0316577_10021865 Ga0316577_100218652 188
151 3300031901 Ga0307406_10145769 Ga0307406_101457692 188
152 3300035111 Ga0373923_0180510 Ga0373923_0180510_235_849 188
153 3300035398 Ga0316574_0649145 Ga0316574_0649145_70_639 188
154 3300036712 Ga0316584_0003091 Ga0316584_0003091_9349_9930 188
155 3300037312 Ga0395899_0040931 Ga0395899_0040931_2686_3267 188
156 3300037312 Ga0395899_0217848 Ga0395899_0217848_267_848 188
157 3300037418 Ga0395900_0025707 Ga0395900_0025707_2416_2997 188
158 3300037418 Ga0395900_0488090 Ga0395900_0488090_127_708 188
159 3300037466 Ga0395898_0063471 Ga0395898_0063471_326_907 188
160 3300037466 Ga0395898_0375114 Ga0395898_0375114_476_1057 188
161 3300037471 Ga0395905_0180636 Ga0395905_0180636_46_627 188
162 3300038443 Ga0395901_0001630 Ga0395901_0001630_4909_5490 188
163 3300038443 Ga0395901_0297516 Ga0395901_0297516_645_1226 188
164 3300044673 Ga0453683_0525040 Ga0453683_0525040_102_671 188
165 3300044712 Ga0453684_0015367 Ga0453684_0015367_3142_3711 188
166 3300046492 Ga0495585_0209368 Ga0495585_0209368_367_969 188
167 3300046558 Ga0495633_0182899 Ga0495633_0182899_318_920 188
168 3300048918 Ga0496115_0192487 Ga0496115_0192487_875_1465 188
169 3300048924 Ga0496121_0211393 Ga0496121_0211393_637_1203 188
170 3300049569 Ga0501032_0331047 Ga0501032_0331047_297_881 188
171 3300049569 Ga0501032_0442135 Ga0501032_0442135_144_728 188
172 3300049571 Ga0501034_0122716 Ga0501034_0122716_380_964 188
173 3300049573 Ga0501037_0062981 Ga0501037_0062981_50_691 188
174 3300049579 Ga0501043_0531461 Ga0501043_0531461_162_791 188
175 3300049579 Ga0501043_0565591 Ga0501043_0565591_179_763 188
176 3300049581 Ga0501047_0129980 Ga0501047_0129980_1149_1730 188
177 3300049586 Ga0501070_0086328 Ga0501070_0086328_1925_2509 188
178 3300049586 Ga0501070_0106526 Ga0501070_0106526_1574_2248 188
179 3300049742 Ga0501080_0275105 Ga0501080_0275105_602_1195 188
180 3300049823 Ga0501044_0284142 Ga0501044_0284142_472_1146 188
181 3300049823 Ga0501044_0324297 Ga0501044_0324297_847_1428 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

32

223

0.94

PF07722

Peptidase_C26

Peptidase C26

89

205

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9557 1 187
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9458 1 187
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9384 1 187
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.9263 3 187
7yc6-assembly1.cif.gz_A crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9229 3 187
ID Description Score Start End Superfamily
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9661 1 188 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9649 3 188 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9611 1 188 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9566 3 187 3.40.50.880
1qdlB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9557 1 187 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A4Q9YV92-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.998 2 188 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A838TKL8-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.998 79 186 GO:0000162
GO:0004049
GO:0005829
GO:0016787
AF-A0A7K0EYQ3-F1-model_v4 deleted 0.9968 1 188
AF-A0A5C7F0V9-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9954 1 188 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2E2SLG3-F1-model_v4 deleted 0.9953 2 188

Feature Viewer

pLDDT pTM Quality
95.82 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map