F277966

General Info

Members Datasets Scaffolds Average Seq Length
181 119 362 425

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0034861|Ga0495586_0034861_694_1971
Length 425
Sequence MIDPKLFRSDPQAVARNLQRRGFVLDIARLQSLEESRKRAQIRADELRNERNTHAKSVGKAKAQGQDIAPLLKQVETLGEELQRAEAELIVAQSELDQLALTTPNLLDESVPDGNDEHGNKEIRRIGEPRKFEFEPKDHVDVGEKLKRLDFAAAGKISGARFTVLSGELARLQRALIQFMLDLHTREHGYREMYVPYLVNADSLKGTGQLPKFEADLFGVKGDQGLYLIPTAEVPVTNLVRDVIVEAKEMPLKFVAHTPCFRSEAGSYGKDTRGMIRQHQFEKVELVQMVRPQDSYAALEELTGHAEQVLQRLHLPYRVMALCAGDVGASAAKTYDLEVWLPGQGKYREISSCSNFEAFQARRMQARWRNPETAKPEPLHTLNGSGVAAGRALVAILENYQQADGSVVVPDVLRPYMGGIDLIRP

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
119 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.87
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0034861 3300046535 Bacteria 2703
2 CNXas_1000216 3300000545 Bacteria 7968
3 JGI24033J26618_1000301 3300002155 Bacteria 5316
4 JGI25406J46586_10000020 3300003203 Bacteria 86123
5 JGI25405J52794_10005038 3300003911 Bacteria 2369
6 Ga0065704_10102653 3300005289 Bacteria 2197
7 Ga0065712_10001730 3300005290 Bacteria 5605
8 Ga0065712_10008871 3300005290 Bacteria 3169
9 Ga0065715_10001488 3300005293 Bacteria 9044
10 Ga0065715_10094046 3300005293 Bacteria 4460
11 Ga0065707_10110963 3300005295 Bacteria 2401
12 Ga0070676_10071384 3300005328 Bacteria 2086
13 Ga0070683_100026080 3300005329 Bacteria 5256
14 Ga0070690_100032461 3300005330 Bacteria 3262
15 Ga0070670_100044349 3300005331 Bacteria 3824
16 Ga0070666_10001477 3300005335 Bacteria 14269
17 Ga0070666_10180375 3300005335 Bacteria 1481
18 Ga0068868_100153382 3300005338 Bacteria 1898
19 Ga0070660_100057319 3300005339 Bacteria 3017
20 Ga0070661_100000351 3300005344 Bacteria 36243
21 Ga0070661_100019720 3300005344 Bacteria 4806
22 Ga0070668_100034138 3300005347 Bacteria 3876
23 Ga0070669_100045473 3300005353 Bacteria 3199
24 Ga0070669_100064399 3300005353 Bacteria 2700
25 Ga0070675_100053990 3300005354 Bacteria 3305
26 Ga0070675_100181242 3300005354 Bacteria 1821
27 Ga0070671_100011840 3300005355 Bacteria 7017
28 Ga0070674_100000429 3300005356 Bacteria 21244
29 Ga0070673_100003059 3300005364 Bacteria 10353
30 Ga0070659_100045996 3300005366 Bacteria 3421
31 Ga0070667_100088012 3300005367 Bacteria 2666
32 Ga0070667_100105053 3300005367 Bacteria 2444
33 Ga0070713_100013816 3300005436 Bacteria 5974
34 Ga0070708_100007352 3300005445 Bacteria 8813
35 Ga0070708_100009931 3300005445 Bacteria 7693
36 Ga0070708_100080729 3300005445 Bacteria 2943
37 Ga0070708_100159788 3300005445 Bacteria 2100
38 Ga0070708_100324079 3300005445 Bacteria 1451
39 Ga0070678_100006673 3300005456 Bacteria 6791
40 Ga0070662_100170577 3300005457 Bacteria 1708
41 Ga0070681_10119985 3300005458 Bacteria 2565
42 Ga0070706_100000012 3300005467 Bacteria 195040
43 Ga0070706_100003151 3300005467 Bacteria 16304
44 Ga0070706_100023802 3300005467 Bacteria 5638
45 Ga0070706_100024737 3300005467 Bacteria 5528
46 Ga0070707_100000171 3300005468 Bacteria 63131
47 Ga0070707_100009190 3300005468 Bacteria 9169
48 Ga0070707_100012766 3300005468 Bacteria 7844
49 Ga0070698_100008614 3300005471 Bacteria 10992
50 Ga0070698_100020903 3300005471 Bacteria 6859
51 Ga0070698_100027137 3300005471 Bacteria 5955
52 Ga0070698_100223127 3300005471 Bacteria 1818
53 Ga0070698_100238096 3300005471 Bacteria 1753
54 Ga0070698_100291172 3300005471 Unclassified 1564
55 Ga0070699_100022471 3300005518 Bacteria 5437
56 Ga0070699_100067030 3300005518 Bacteria 3117
57 Ga0070697_100001418 3300005536 Bacteria 18201
58 Ga0070697_100011315 3300005536 Bacteria 6971
59 Ga0070697_100011449 3300005536 Bacteria 6934
60 Ga0070697_100011929 3300005536 Bacteria 6803
61 Ga0070697_100019179 3300005536 Bacteria 5400
62 Ga0070697_100027043 3300005536 Bacteria 4587
63 Ga0070697_100054358 3300005536 Bacteria 3254
64 Ga0070672_100101915 3300005543 Bacteria 2329
65 Ga0070665_100039841 3300005548 Bacteria 4723
66 Ga0070664_100029941 3300005564 Bacteria 4539
67 Ga0068856_100000603 3300005614 Bacteria 39333
68 Ga0068858_100048829 3300005842 Bacteria 3920
69 Ga0068860_100000107 3300005843 Bacteria 133502
70 Ga0068862_100086135 3300005844 Bacteria 2731
71 Ga0081455_10000171 3300005937 Bacteria 80763
72 Ga0081455_10006467 3300005937 Bacteria 12558
73 Ga0081455_10007827 3300005937 Bacteria 11189
74 Ga0081539_10000052 3300005985 Bacteria 268240
75 Ga0070717_10053187 3300006028 Bacteria 3337
76 Ga0070712_100071548 3300006175 Bacteria 2482
77 Ga0097621_100019952 3300006237 Bacteria 5158
78 Ga0097621_100040295 3300006237 Bacteria 3755
79 Ga0097621_100058076 3300006237 Bacteria 3165
80 Ga0097621_100108582 3300006237 Bacteria 2343
81 Ga0068871_100096404 3300006358 Bacteria 2471
82 Ga0068865_100007572 3300006881 Bacteria 6684
83 Ga0075436_100120682 3300006914 Bacteria 1834
84 Ga0075435_100071095 3300007076 Bacteria 2841
85 Ga0099795_10047531 3300007788 Bacteria 1551
86 Ga0114129_10004779 3300009147 Bacteria 19142
87 Ga0105242_10023967 3300009176 Bacteria 4816
88 Ga0105242_10048085 3300009176 Bacteria 3465
89 Ga0099796_10000879 3300010159 Bacteria 5565
90 Ga0157374_10000797 3300013296 Bacteria 27660
91 Ga0157374_10024547 3300013296 Bacteria 5406
92 Ga0157374_10307841 3300013296 Bacteria 1568
93 Ga0157378_10025610 3300013297 Bacteria 5193
94 Ga0157378_10069421 3300013297 Bacteria 3161
95 Ga0157378_10073089 3300013297 Bacteria 3082
96 Ga0163162_10000863 3300013306 Bacteria 28273
97 Ga0163162_10089552 3300013306 Bacteria 3158
98 Ga0157375_10005209 3300013308 Bacteria 11281
99 Ga0157375_10020283 3300013308 Bacteria 6068
100 Ga0157375_10211581 3300013308 Archaea 2096
101 Ga0163163_10254307 3300014325 Unclassified 1807
102 Ga0157376_10000097 3300014969 Bacteria 65460
103 Ga0157376_10032806 3300014969 Bacteria 4173
104 Ga0207697_10005550 3300025315 Bacteria 5844
105 Ga0207697_10015575 3300025315 Bacteria 3140
106 Ga0207688_10002691 3300025901 Bacteria 9622
107 Ga0207688_10013299 3300025901 Unclassified 4471
108 Ga0207688_10019127 3300025901 Bacteria 3729
109 Ga0207680_10010819 3300025903 Bacteria 4581
110 Ga0207680_10012929 3300025903 Bacteria 4267
111 Ga0207680_10100261 3300025903 Unclassified 1859
112 Ga0207699_10023560 3300025906 Bacteria 3351
113 Ga0207645_10006612 3300025907 Bacteria 8288
114 Ga0207645_10182540 3300025907 Bacteria 1377
115 Ga0207684_10000028 3300025910 Bacteria 306450
116 Ga0207684_10021097 3300025910 Bacteria 5562
117 Ga0207684_10045568 3300025910 Bacteria 3719
118 Ga0207684_10055548 3300025910 Bacteria 3359
119 Ga0207695_10000644 3300025913 Bacteria 69302
120 Ga0207693_10023155 3300025915 Bacteria 4932
121 Ga0207660_10037322 3300025917 Bacteria 3385
122 Ga0207657_10122917 3300025919 Bacteria 2134
123 Ga0207649_10000462 3300025920 Bacteria 29231
124 Ga0207646_10000750 3300025922 Bacteria 42120
125 Ga0207646_10035693 3300025922 Bacteria 4490
126 Ga0207646_10041296 3300025922 Bacteria 4148
127 Ga0207681_10031878 3300025923 Bacteria 3445
128 Ga0207681_10179263 3300025923 Bacteria 1612
129 Ga0207650_10008577 3300025925 Bacteria 6979
130 Ga0207650_10077305 3300025925 Bacteria 2516
131 Ga0207659_10053913 3300025926 Bacteria 2870
132 Ga0207644_10004902 3300025931 Bacteria 8722
133 Ga0207644_10211854 3300025931 Bacteria 1532
134 Ga0207706_10016145 3300025933 Bacteria 6745
135 Ga0207686_10025060 3300025934 Bacteria 3465
136 Ga0207670_10075002 3300025936 Bacteria 2350
137 Ga0207669_10040611 3300025937 Bacteria 2700
138 Ga0207665_10133330 3300025939 Bacteria 1765
139 Ga0207691_10000682 3300025940 Bacteria 33522
140 Ga0207691_10021428 3300025940 Bacteria 6102
141 Ga0207667_10007124 3300025949 Bacteria 13498
142 Ga0207651_10022818 3300025960 Bacteria 3836
143 Ga0207651_10059392 3300025960 Bacteria 2649
144 Ga0207668_10037945 3300025972 Bacteria 3229
145 Ga0207658_10009619 3300025986 Bacteria 6561
146 Ga0207703_10063737 3300026035 Bacteria 3023
147 Ga0207641_10068059 3300026088 Bacteria 3052
148 Ga0207641_10097398 3300026088 Bacteria 2586
149 Ga0207683_10015855 3300026121 Bacteria 6416
150 Ga0268266_10028588 3300028379 Bacteria 4737
151 Ga0268264_10000501 3300028381 Bacteria 50746
152 Ga0373945_0023033 3300035116 Bacteria 2150
153 Ga0373943_0062885 3300035170 Bacteria 1859
154 Ga0373937_0069250 3300036401 Bacteria 3253
155 Ga0395899_0000015 3300037312 Bacteria 470061
156 Ga0395898_0000047 3300037466 Bacteria 294005
157 Ga0395898_0011100 3300037466 Bacteria 9378
158 Ga0395905_0009339 3300037471 Bacteria 9592
159 Ga0395901_0000371 3300038443 Bacteria 53982
160 Ga0395901_0086896 3300038443 Bacteria 3270
161 Ga0436365_1774477 3300039437 Bacteria 12178
162 Ga0466957_0027923 3300044842 Bacteria 3356
163 Ga0451576_0011857 3300045051 Bacteria 9863
164 Ga0495651_0009829 3300046462 Bacteria 7354
165 Ga0495658_0033706 3300046683 Bacteria 2807
166 Ga0495658_0046146 3300046683 Bacteria 2449
167 Ga0495684_0073046 3300047471 Bacteria 2606
168 Ga0496102_0101219 3300048905 Bacteria 2676
169 Ga0496103_0059723 3300048906 Bacteria 2369
170 Ga0496108_0089311 3300048911 Bacteria 2619
171 Ga0496109_0032757 3300048912 Bacteria 4674
172 Ga0496110_0039379 3300048913 Bacteria 4115
173 Ga0496112_0054447 3300048915 Bacteria 3931
174 Ga0496115_0087357 3300048918 Bacteria 2544
175 Ga0496125_0000102 3300048928 Bacteria 201692
176 Ga0501032_0000078 3300049569 Bacteria 83541
177 Ga0501033_0000001 3300049570 Bacteria 795921
178 Ga0501038_0000134 3300049574 Bacteria 63582
179 nmdc:mga0a205_313190_c1 3300050515 Bacteria 1441
180 Ga0500645_011799 3300053730 Bacteria 2840
181 2787509516 2786546548 Bacteria 4745694
182 Ga0495586_0034861
183 CNXas_1000216
184 JGI24033J26618_1000301
185 JGI25406J46586_10000020
186 JGI25405J52794_10005038
187 Ga0065704_10102653
188 Ga0065712_10001730
189 Ga0065712_10008871
190 Ga0065715_10001488
191 Ga0065715_10094046
192 Ga0065707_10110963
193 Ga0070676_10071384
194 Ga0070683_100026080
195 Ga0070690_100032461
196 Ga0070670_100044349
197 Ga0070666_10001477
198 Ga0070666_10180375
199 Ga0068868_100153382
200 Ga0070660_100057319
201 Ga0070661_100000351
202 Ga0070661_100019720
203 Ga0070668_100034138
204 Ga0070669_100045473
205 Ga0070669_100064399
206 Ga0070675_100053990
207 Ga0070675_100181242
208 Ga0070671_100011840
209 Ga0070674_100000429
210 Ga0070673_100003059
211 Ga0070659_100045996
212 Ga0070667_100088012
213 Ga0070667_100105053
214 Ga0070713_100013816
215 Ga0070708_100007352
216 Ga0070708_100009931
217 Ga0070708_100080729
218 Ga0070708_100159788
219 Ga0070708_100324079
220 Ga0070678_100006673
221 Ga0070662_100170577
222 Ga0070681_10119985
223 Ga0070706_100000012
224 Ga0070706_100003151
225 Ga0070706_100023802
226 Ga0070706_100024737
227 Ga0070707_100000171
228 Ga0070707_100009190
229 Ga0070707_100012766
230 Ga0070698_100008614
231 Ga0070698_100020903
232 Ga0070698_100027137
233 Ga0070698_100223127
234 Ga0070698_100238096
235 Ga0070698_100291172
236 Ga0070699_100022471
237 Ga0070699_100067030
238 Ga0070697_100001418
239 Ga0070697_100011315
240 Ga0070697_100011449
241 Ga0070697_100011929
242 Ga0070697_100019179
243 Ga0070697_100027043
244 Ga0070697_100054358
245 Ga0070672_100101915
246 Ga0070665_100039841
247 Ga0070664_100029941
248 Ga0068856_100000603
249 Ga0068858_100048829
250 Ga0068860_100000107
251 Ga0068862_100086135
252 Ga0081455_10000171
253 Ga0081455_10006467
254 Ga0081455_10007827
255 Ga0081539_10000052
256 Ga0070717_10053187
257 Ga0070712_100071548
258 Ga0097621_100019952
259 Ga0097621_100040295
260 Ga0097621_100058076
261 Ga0097621_100108582
262 Ga0068871_100096404
263 Ga0068865_100007572
264 Ga0075436_100120682
265 Ga0075435_100071095
266 Ga0099795_10047531
267 Ga0114129_10004779
268 Ga0105242_10023967
269 Ga0105242_10048085
270 Ga0099796_10000879
271 Ga0157374_10000797
272 Ga0157374_10024547
273 Ga0157374_10307841
274 Ga0157378_10025610
275 Ga0157378_10069421
276 Ga0157378_10073089
277 Ga0163162_10000863
278 Ga0163162_10089552
279 Ga0157375_10005209
280 Ga0157375_10020283
281 Ga0157375_10211581
282 Ga0163163_10254307
283 Ga0157376_10000097
284 Ga0157376_10032806
285 Ga0207697_10005550
286 Ga0207697_10015575
287 Ga0207688_10002691
288 Ga0207688_10013299
289 Ga0207688_10019127
290 Ga0207680_10010819
291 Ga0207680_10012929
292 Ga0207680_10100261
293 Ga0207699_10023560
294 Ga0207645_10006612
295 Ga0207645_10182540
296 Ga0207684_10000028
297 Ga0207684_10021097
298 Ga0207684_10045568
299 Ga0207684_10055548
300 Ga0207695_10000644
301 Ga0207693_10023155
302 Ga0207660_10037322
303 Ga0207657_10122917
304 Ga0207649_10000462
305 Ga0207646_10000750
306 Ga0207646_10035693
307 Ga0207646_10041296
308 Ga0207681_10031878
309 Ga0207681_10179263
310 Ga0207650_10008577
311 Ga0207650_10077305
312 Ga0207659_10053913
313 Ga0207644_10004902
314 Ga0207644_10211854
315 Ga0207706_10016145
316 Ga0207686_10025060
317 Ga0207670_10075002
318 Ga0207669_10040611
319 Ga0207665_10133330
320 Ga0207691_10000682
321 Ga0207691_10021428
322 Ga0207667_10007124
323 Ga0207651_10022818
324 Ga0207651_10059392
325 Ga0207668_10037945
326 Ga0207658_10009619
327 Ga0207703_10063737
328 Ga0207641_10068059
329 Ga0207641_10097398
330 Ga0207683_10015855
331 Ga0268266_10028588
332 Ga0268264_10000501
333 Ga0373945_0023033
334 Ga0373943_0062885
335 Ga0373937_0069250
336 Ga0395899_0000015
337 Ga0395898_0000047
338 Ga0395898_0011100
339 Ga0395905_0009339
340 Ga0395901_0000371
341 Ga0395901_0086896
342 Ga0436365_1774477
343 Ga0466957_0027923
344 Ga0451576_0011857
345 Ga0495651_0009829
346 Ga0495658_0033706
347 Ga0495658_0046146
348 Ga0495684_0073046
349 Ga0496102_0101219
350 Ga0496103_0059723
351 Ga0496108_0089311
352 Ga0496109_0032757
353 Ga0496110_0039379
354 Ga0496112_0054447
355 Ga0496115_0087357
356 Ga0496125_0000102
357 Ga0501032_0000078
358 Ga0501033_0000001
359 Ga0501038_0000134
360 nmdc:mga0a205_313190_c1
361 Ga0500645_011799
362 2787509516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02403

Seryl_tRNA_N

Seryl-tRNA synthetase N-terminal domain

1

107

0.98

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

214

400

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1skv-assembly1.cif.gz_B crystal structure of d-63 from sulfolobus spindle virus 1 0.9774 47 105
1skv-assembly1.cif.gz_A crystal structure of d-63 from sulfolobus spindle virus 1 0.9639 43 103
1cxz-assembly1.cif.gz_B crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1 0.9597 41 104
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9591 40 108
8iyj-assembly1.cif.gz_V9 cryo-em structure of the 48-nm repeat doublet microtubule from mouse sperm 0.9434 33 109
ID Description Score Start End Superfamily
af_A0A1D6E3A6_364_661_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9864 36 109 1.20.1270.60
af_A0A1D6NKS2_269_572_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9855 35 109 1.20.1270.60
af_K7U635_363_662_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9824 36 109 1.20.1270.60
af_Q16512_13_98_1.10.287.160 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9732 41 104 1.10.287.160
af_Q9SZW6_305_633_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9724 35 109 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A3P7REJ8-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) 0.9861 326 411 GO:0004828
GO:0005524
GO:0006434
AF-A0A257NUA9-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9847 296 431 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A4U3LQ03-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9844 318 431 GO:0004828
GO:0005524
GO:0005737
GO:0006434
GO:0016740
AF-A0A660PV59-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9838 322 431 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A821JPS9-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) 0.9826 308 430 GO:0004828
GO:0005524
GO:0006434

Map