F277795

General Info

Members Datasets Scaffolds Average Seq Length
181 137 362 220

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1618365|Ga0451853_1618365_280_1035
Length 251
Sequence LTIRVVVADDQELVRSGFALILDVQPDIEVVAEVGDGAAAVEAVRRHRADVALLDVRMPRTDGIEACRAIKESGGAGXXDDGCRVVMLTTFDTDEYVYEALHAGASGFLLKDVRRDDLVHAVRVVARGDSLLAPSVARRLVEQYTRPAAARAARPDPRLDVLTGRERETLLLLARGLSNAEIAAELVVSDHTVKTHVGNVLAKLGLRDRIQAVICAYETGLIAAGDARAPVAGPPPGGVLRPGSSPASARK

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
114 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
115 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
116 2643221670 Streptomyces sp. Root431 Isolate Unclassified
117 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
118 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
119 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
120 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
121 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
122 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
123 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
124 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
125 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
126 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
127 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
128 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
129 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
130 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
131 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
132 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
133 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
134 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
135 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
136 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
137 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.08
Metatranscriptomes 0.55
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0.55
Rhizoplane 6.63
Rhizosphere 69.61
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1618365 3300041512 Bacteria 1275
2 JGI24744J21845_10040090 3300002077 Bacteria 877
3 Ga0070658_10088393 3300005327 Bacteria 2551
4 Ga0070658_10091558 3300005327 Bacteria 2506
5 Ga0070683_100014692 3300005329 Bacteria 6859
6 Ga0070683_100123912 3300005329 Bacteria 2442
7 Ga0070683_100738585 3300005329 Bacteria 943
8 Ga0070680_100034916 3300005336 Bacteria 4057
9 Ga0070682_100399698 3300005337 Bacteria 1039
10 Ga0068868_100427448 3300005338 Bacteria 1148
11 Ga0070661_100023329 3300005344 Bacteria 4434
12 Ga0070675_100149643 3300005354 Bacteria 2001
13 Ga0070659_100040904 3300005366 Bacteria 3623
14 Ga0070714_100043971 3300005435 Bacteria 3780
15 Ga0070714_100679167 3300005435 Bacteria 993
16 Ga0070713_100205051 3300005436 Bacteria 1782
17 Ga0070710_10000040 3300005437 Bacteria 60294
18 Ga0070679_100037699 3300005530 Bacteria 4803
19 Ga0070684_100077802 3300005535 Bacteria 2930
20 Ga0070684_100089405 3300005535 Bacteria 2737
21 Ga0070684_100950989 3300005535 Bacteria 806
22 Ga0068853_100056724 3300005539 Bacteria 3379
23 Ga0068853_100473124 3300005539 Bacteria 1181
24 Ga0070665_100413028 3300005548 Bacteria 1358
25 Ga0068855_100105178 3300005563 Bacteria 3245
26 Ga0068857_100206285 3300005577 Bacteria 1793
27 Ga0068856_100803123 3300005614 Bacteria 960
28 Ga0068864_100728077 3300005618 Bacteria 971
29 Ga0081455_10350152 3300005937 Bacteria 1042
30 Ga0081538_10040157 3300005981 Bacteria 2989
31 Ga0081540_1000095 3300005983 Bacteria 92795
32 Ga0081540_1005018 3300005983 Bacteria 9940
33 Ga0068871_100589668 3300006358 Bacteria 1010
34 Ga0105243_10202938 3300009148 Bacteria 1740
35 Ga0105239_10369651 3300010375 Bacteria 1620
36 Ga0105239_10767650 3300010375 Bacteria 1104
37 Ga0157370_10156973 3300013104 Bacteria 2117
38 Ga0163163_10056480 3300014325 Bacteria 3880
39 Ga0157379_10997026 3300014968 Bacteria 798
40 Ga0206353_10193590 3300020082 Bacteria 2584
41 Ga0213876_10205706 3300021384 Bacteria 1046
42 Ga0213875_10026432 3300021388 Bacteria 2761
43 Ga0213875_10056467 3300021388 Bacteria 1839
44 Ga0213875_10142832 3300021388 Bacteria 1121
45 Ga0207426_1010036 3300025302 Bacteria 3702
46 Ga0207692_10000096 3300025898 Bacteria 25642
47 Ga0207705_10049144 3300025909 Bacteria 3036
48 Ga0207705_10100680 3300025909 Bacteria 2125
49 Ga0207705_10106545 3300025909 Bacteria 2067
50 Ga0207707_10450545 3300025912 Bacteria 1101
51 Ga0207649_10028090 3300025920 Bacteria 3309
52 Ga0207652_10027345 3300025921 Bacteria 4752
53 Ga0207694_10301201 3300025924 Bacteria 1320
54 Ga0207700_10141614 3300025928 Bacteria 1976
55 Ga0207664_10043877 3300025929 Bacteria 3500
56 Ga0207664_10222605 3300025929 Bacteria 1637
57 Ga0207690_10070638 3300025932 Bacteria 2406
58 Ga0207665_10218539 3300025939 Bacteria 1396
59 Ga0207661_10004312 3300025944 Bacteria 9955
60 Ga0207661_10097108 3300025944 Bacteria 2466
61 Ga0207667_10140338 3300025949 Bacteria 2488
62 Ga0207639_10128640 3300026041 Bacteria 2093
63 Ga0207639_10426123 3300026041 Bacteria 1200
64 Ga0307515_10000739 3300028794 Bacteria 75653
65 Ga0307515_10063659 3300028794 Bacteria 5174
66 Ga0307512_10011233 3300030522 Bacteria 8497
67 Ga0307512_10027063 3300030522 Bacteria 5055
68 Ga0307513_10036008 3300031456 Bacteria 5531
69 Ga0307513_10047815 3300031456 Bacteria 4650
70 Ga0307513_10069453 3300031456 Bacteria 3686
71 Ga0307514_10052093 3300031649 Bacteria 3166
72 Ga0307405_10322070 3300031731 Bacteria 1181
73 Ga0307410_10872894 3300031852 Bacteria 769
74 Ga0307409_100127046 3300031995 Bacteria 2171
75 Ga0307409_100212063 3300031995 Bacteria 1741
76 Ga0307415_100045346 3300032126 Bacteria 2947
77 Ga0307415_100180941 3300032126 Bacteria 1654
78 Ga0307415_100899886 3300032126 Bacteria 816
79 Ga0307507_10033680 3300033179 Bacteria 5313
80 Ga0373951_0000052 3300035091 Bacteria 46256
81 Ga0373931_0171151 3300035691 Bacteria 1280
82 Ga0395900_0304641 3300037418 Bacteria 1578
83 Ga0395898_0077570 3300037466 Bacteria 3207
84 Ga0395905_0102228 3300037471 Bacteria 2690
85 Ga0395905_0285082 3300037471 Bacteria 1538
86 Ga0436364_0643535 3300037853 Bacteria 3716
87 Ga0436364_1299139 3300037853 Bacteria 2762
88 Ga0436364_1372061 3300037853 Bacteria 6818
89 Ga0395901_0352074 3300038443 Bacteria 1520
90 Ga0436365_0958151 3300039437 Bacteria 848
91 Ga0436365_1126809 3300039437 Bacteria 694
92 Ga0436365_1297032 3300039437 Bacteria 1836
93 Ga0451853_0291736 3300041512 Bacteria 2497
94 Ga0439449_0084441 3300042007 Bacteria 1171
95 Ga0451577_0382378 3300042876 Unclassified 1277
96 Ga0466972_0000945 3300044658 Bacteria 13970
97 Ga0453683_0188565 3300044673 Unclassified 1308
98 Ga0466965_0033567 3300044683 Bacteria 2508
99 Ga0466965_0054747 3300044683 Bacteria 1985
100 Ga0466961_0175747 3300044693 Bacteria 1331
101 Ga0466964_0224612 3300044706 Bacteria 914
102 Ga0453684_0421634 3300044712 Unclassified 1490
103 Ga0466968_0039367 3300044735 Bacteria 1990
104 Ga0466968_0061682 3300044735 Bacteria 1618
105 Ga0466970_0207371 3300044765 Bacteria 1091
106 Ga0466970_0324528 3300044765 Bacteria 871
107 Ga0466957_0106568 3300044842 Bacteria 1773
108 Ga0451576_0059232 3300045051 Bacteria 3998
109 Ga0495629_0411045 3300046459 Bacteria 919
110 Ga0495582_0292035 3300046473 Bacteria 937
111 Ga0495664_0108297 3300046477 Bacteria 1676
112 Ga0495647_0135377 3300046681 Bacteria 1047
113 Ga0496102_0128818 3300048905 Bacteria 2367
114 Ga0496104_0021387 3300048907 Bacteria 5939
115 Ga0496104_0262726 3300048907 Bacteria 1639
116 Ga0496104_0370383 3300048907 Bacteria 1345
117 Ga0496106_0179023 3300048909 Bacteria 1682
118 Ga0496110_0225660 3300048913 Bacteria 1703
119 Ga0496111_0054246 3300048914 Bacteria 2897
120 Ga0496112_0196176 3300048915 Bacteria 1979
121 Ga0496113_0175473 3300048916 Bacteria 1698
122 Ga0496113_0258936 3300048916 Bacteria 1390
123 Ga0496114_0069998 3300048917 Bacteria 2946
124 Ga0496114_0088875 3300048917 Bacteria 2621
125 Ga0496125_0148283 3300048928 Bacteria 1617
126 Ga0501031_0022057 3300049568 Bacteria 4149
127 Ga0501032_0052880 3300049569 Bacteria 2736
128 Ga0501034_0054605 3300049571 Bacteria 4021
129 Ga0501034_0054787 3300049571 Bacteria 4014
130 Ga0501037_0061538 3300049573 Bacteria 2737
131 Ga0501037_0188426 3300049573 Bacteria 1461
132 Ga0501039_0072378 3300049575 Bacteria 2678
133 Ga0501040_0457546 3300049576 Bacteria 919
134 Ga0501043_0040413 3300049579 Bacteria 3665
135 Ga0501047_0020673 3300049581 Bacteria 6320
136 Ga0501047_0062208 3300049581 Bacteria 3601
137 Ga0501047_0217252 3300049581 Bacteria 1769
138 Ga0501070_0018833 3300049586 Bacteria 5792
139 Ga0501072_0411392 3300049588 Bacteria 1072
140 Ga0501073_0015778 3300049589 Bacteria 5474
141 Ga0501073_0067650 3300049589 Bacteria 2490
142 Ga0501074_0006465 3300049590 Bacteria 8465
143 Ga0501077_0239287 3300049593 Bacteria 1154
144 Ga0501079_0016279 3300049741 Bacteria 5681
145 Ga0501080_0010307 3300049742 Bacteria 8545
146 Ga0501080_0260722 3300049742 Bacteria 1579
147 Ga0501083_0117926 3300049744 Bacteria 1741
148 Ga0501044_0051441 3300049823 Bacteria 4248
149 Ga0501044_0323667 3300049823 Bacteria 1465
150 Ga0495601_0062771 3300053077 Bacteria 2360
151 Ga0500568_0021688 3300053139 Bacteria 2760
152 Ga0500573_0016751 3300053140 Bacteria 4165
153 Ga0500616_0001307 3300053153 Bacteria 24658
154 Ga0501084_0030768 3300054114 Bacteria 4489
155 Ga0501082_0045173 3300060353 Bacteria 3799
156 2643943693 2643221587 Bacteria 7586415
157 2644019694 2643221601 Bacteria 7493239
158 2644180418 2643221631 Bacteria 8168043
159 2644387172 2643221670 Bacteria 6497041
160 2644390446 2643221670 Bacteria 6497041
161 2644434048 2643221677 Bacteria 7584031
162 2676493555 2675903060 Bacteria 10051191
163 2753075495 2751185734 Bacteria 8863695
164 2791916650 2791354901 Bacteria 8322202
165 2812357402 2811994879 Bacteria 9313447
166 2862181803 2862178590 Bacteria 8583590
167 2863412501 2863404153 Bacteria 9672205
168 2867302781 2867302475 Bacteria 7087181
169 2868089027 2868088558 Bacteria 7609351
170 2870721652 2870721527 Bacteria 9689237
171 2880490233 2880489317 Bacteria 7096270
172 2884704241 2884693830 Bacteria 11273186
173 2895434335 2895427314 Bacteria 13147766
174 2895448450 2895442618 Bacteria 11027144
175 2918506801 2918501144 Bacteria 8668083
176 2929224089 2929219909 Bacteria 6984360
177 2946068461 2946064051 Bacteria 8957905
178 2946076575 2946072368 Bacteria 8999607
179 3006501487 3006493962 Bacteria 8825450
180 8055068061 8055066027 Bacteria 9479577
181 8055416062 8055412473 Bacteria 6257500
182 Ga0451853_1618365
183 JGI24744J21845_10040090
184 Ga0070658_10088393
185 Ga0070658_10091558
186 Ga0070683_100014692
187 Ga0070683_100123912
188 Ga0070683_100738585
189 Ga0070680_100034916
190 Ga0070682_100399698
191 Ga0068868_100427448
192 Ga0070661_100023329
193 Ga0070675_100149643
194 Ga0070659_100040904
195 Ga0070714_100043971
196 Ga0070714_100679167
197 Ga0070713_100205051
198 Ga0070710_10000040
199 Ga0070679_100037699
200 Ga0070684_100077802
201 Ga0070684_100089405
202 Ga0070684_100950989
203 Ga0068853_100056724
204 Ga0068853_100473124
205 Ga0070665_100413028
206 Ga0068855_100105178
207 Ga0068857_100206285
208 Ga0068856_100803123
209 Ga0068864_100728077
210 Ga0081455_10350152
211 Ga0081538_10040157
212 Ga0081540_1000095
213 Ga0081540_1005018
214 Ga0068871_100589668
215 Ga0105243_10202938
216 Ga0105239_10369651
217 Ga0105239_10767650
218 Ga0157370_10156973
219 Ga0163163_10056480
220 Ga0157379_10997026
221 Ga0206353_10193590
222 Ga0213876_10205706
223 Ga0213875_10026432
224 Ga0213875_10056467
225 Ga0213875_10142832
226 Ga0207426_1010036
227 Ga0207692_10000096
228 Ga0207705_10049144
229 Ga0207705_10100680
230 Ga0207705_10106545
231 Ga0207707_10450545
232 Ga0207649_10028090
233 Ga0207652_10027345
234 Ga0207694_10301201
235 Ga0207700_10141614
236 Ga0207664_10043877
237 Ga0207664_10222605
238 Ga0207690_10070638
239 Ga0207665_10218539
240 Ga0207661_10004312
241 Ga0207661_10097108
242 Ga0207667_10140338
243 Ga0207639_10128640
244 Ga0207639_10426123
245 Ga0307515_10000739
246 Ga0307515_10063659
247 Ga0307512_10011233
248 Ga0307512_10027063
249 Ga0307513_10036008
250 Ga0307513_10047815
251 Ga0307513_10069453
252 Ga0307514_10052093
253 Ga0307405_10322070
254 Ga0307410_10872894
255 Ga0307409_100127046
256 Ga0307409_100212063
257 Ga0307415_100045346
258 Ga0307415_100180941
259 Ga0307415_100899886
260 Ga0307507_10033680
261 Ga0373951_0000052
262 Ga0373931_0171151
263 Ga0395900_0304641
264 Ga0395898_0077570
265 Ga0395905_0102228
266 Ga0395905_0285082
267 Ga0436364_0643535
268 Ga0436364_1299139
269 Ga0436364_1372061
270 Ga0395901_0352074
271 Ga0436365_0958151
272 Ga0436365_1126809
273 Ga0436365_1297032
274 Ga0451853_0291736
275 Ga0439449_0084441
276 Ga0451577_0382378
277 Ga0466972_0000945
278 Ga0453683_0188565
279 Ga0466965_0033567
280 Ga0466965_0054747
281 Ga0466961_0175747
282 Ga0466964_0224612
283 Ga0453684_0421634
284 Ga0466968_0039367
285 Ga0466968_0061682
286 Ga0466970_0207371
287 Ga0466970_0324528
288 Ga0466957_0106568
289 Ga0451576_0059232
290 Ga0495629_0411045
291 Ga0495582_0292035
292 Ga0495664_0108297
293 Ga0495647_0135377
294 Ga0496102_0128818
295 Ga0496104_0021387
296 Ga0496104_0262726
297 Ga0496104_0370383
298 Ga0496106_0179023
299 Ga0496110_0225660
300 Ga0496111_0054246
301 Ga0496112_0196176
302 Ga0496113_0175473
303 Ga0496113_0258936
304 Ga0496114_0069998
305 Ga0496114_0088875
306 Ga0496125_0148283
307 Ga0501031_0022057
308 Ga0501032_0052880
309 Ga0501034_0054605
310 Ga0501034_0054787
311 Ga0501037_0061538
312 Ga0501037_0188426
313 Ga0501039_0072378
314 Ga0501040_0457546
315 Ga0501043_0040413
316 Ga0501047_0020673
317 Ga0501047_0062208
318 Ga0501047_0217252
319 Ga0501070_0018833
320 Ga0501072_0411392
321 Ga0501073_0015778
322 Ga0501073_0067650
323 Ga0501074_0006465
324 Ga0501077_0239287
325 Ga0501079_0016279
326 Ga0501080_0010307
327 Ga0501080_0260722
328 Ga0501083_0117926
329 Ga0501044_0051441
330 Ga0501044_0323667
331 Ga0495601_0062771
332 Ga0500568_0021688
333 Ga0500573_0016751
334 Ga0500616_0001307
335 Ga0501084_0030768
336 Ga0501082_0045173
337 2643943693
338 2644019694
339 2644180418
340 2644387172
341 2644390446
342 2644434048
343 2676493555
344 2753075495
345 2791916650
346 2812357402
347 2862181803
348 2863412501
349 2867302781
350 2868089027
351 2870721652
352 2880490233
353 2884704241
354 2895434335
355 2895448450
356 2918506801
357 2929224089
358 2946068461
359 2946076575
360 3006501487
361 8055068061
362 8055416062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

123

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

160

216

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9757 153 207
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9746 149 213
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9738 151 213
1zlk-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex 0.9695 150 211
1zlj-assembly4.cif.gz_H crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9624 149 211
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 153 207 1.10.10.10
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9695 150 211 1.10.10.10
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9584 1 119 3.40.50.2300
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9572 149 214 1.10.10.10
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9511 1 116 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3A9ZYZ5-F1-model_v4 Response regulator 0.9615 2 217 GO:0000160
GO:0003677
GO:0006355
AF-A0A327ZML7-F1-model_v4 LuxR family two component transcriptional regulator 0.9598 1 220 GO:0000160
GO:0003677
GO:0006355
AF-A0A3N1HIW3-F1-model_v4 LuxR family two component transcriptional regulator 0.9579 1 216 GO:0000160
GO:0003677
GO:0006355
AF-V6KGX9-F1-model_v4 deleted 0.9574 1 217
AF-A0A4R1DQK2-F1-model_v4 deleted 0.9557 2 216

Map