F277315
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 181 | 165 | 103 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10113545|Ga0105248_101135454 |
| Length | 358 |
| Sequence | MNAVNDTPSPVRLAQLPWICMGRQSGPGCGGKKAHLVASQGKCQRRFVMISRNNIAAAAARIGGHVRHTPVIRLNSIDCEMNLPVTLKLELLQHTGSFKPRGAFNRLLSASVPGAGVIAASGGNHGAAVAYAARILGVSAEIFVPCTTPATKVARIKSYGARVVQAGANYAEALAACRDRQAETGALEVHAYDHPDVLAGQGTVGREFEQDAPELTHLLVATGGGGLIGGIAAWYASSAEVVSVEPKSCPTLHDALRAGHPVDAQVGGLAADSLGARQVGSLMFPIAQAHVAASVLVPDAAIAQAQRLLWDRLRLVAEPGGATALAALLCGAFEAPAHAQVGVLVCGANTDPSKVADA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 2 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 3 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 4 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 5 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 6 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 7 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 8 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 9 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 10 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 11 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 12 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 13 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 14 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 15 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 16 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 17 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 18 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 19 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 20 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 21 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 22 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 23 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 24 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 25 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 26 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 27 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 28 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 29 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 30 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 31 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 32 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 33 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 34 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 35 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 36 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 37 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 38 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 39 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 40 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 41 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 42 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 43 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 44 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 45 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 46 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 47 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 48 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 49 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 50 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 51 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 52 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 53 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 54 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 55 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 56 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 57 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 58 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 59 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 60 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 61 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 62 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 63 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 64 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 65 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 66 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 67 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 68 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 69 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 70 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 71 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 72 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 73 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 74 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 75 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 76 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 134 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 135 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 139 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 161 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 162 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 163 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 164 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 165 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.91 |
| Metatranscriptomes | 0 |
| Isolates | 43.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.08 |
| Nodule | 40.33 |
| Rhizoplane | 1.1 |
| Rhizosphere | 47.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10001605 | 3300003187 | Bacteria | 14988 |
| 2 | JGI25160J50197_1004393 | 3300003354 | Bacteria | 6106 |
| 3 | Ga0070683_100206488 | 3300005329 | Bacteria | 1866 |
| 4 | Ga0070671_100011170 | 3300005355 | Bacteria | 7211 |
| 5 | Ga0070674_100033106 | 3300005356 | Bacteria | 3438 |
| 6 | Ga0070713_100269696 | 3300005436 | Bacteria | 1558 |
| 7 | Ga0070710_10051434 | 3300005437 | Bacteria | 2313 |
| 8 | Ga0070701_10104161 | 3300005438 | Bacteria | 1576 |
| 9 | Ga0070705_100124572 | 3300005440 | Bacteria | 1670 |
| 10 | Ga0070708_100003906 | 3300005445 | Bacteria | 11701 |
| 11 | Ga0070678_100227744 | 3300005456 | Bacteria | 1552 |
| 12 | Ga0070707_100001270 | 3300005468 | Bacteria | 24819 |
| 13 | Ga0070698_100000011 | 3300005471 | Bacteria | 116801 |
| 14 | Ga0070698_100001295 | 3300005471 | Bacteria | 27867 |
| 15 | Ga0070699_100085945 | 3300005518 | Bacteria | 2745 |
| 16 | Ga0070696_100032609 | 3300005546 | Bacteria | 3574 |
| 17 | Ga0070665_100066973 | 3300005548 | Bacteria | 3602 |
| 18 | Ga0070665_100567277 | 3300005548 | Bacteria | 1148 |
| 19 | Ga0070717_10004263 | 3300006028 | Bacteria | 10308 |
| 20 | Ga0070717_10214758 | 3300006028 | Bacteria | 1689 |
| 21 | Ga0075431_100024741 | 3300006847 | Bacteria | 6156 |
| 22 | Ga0075429_100185405 | 3300006880 | Bacteria | 1823 |
| 23 | Ga0105240_10358089 | 3300009093 | Bacteria | 1654 |
| 24 | Ga0111539_10000096 | 3300009094 | Bacteria | 92188 |
| 25 | Ga0105245_10280885 | 3300009098 | Bacteria | 1627 |
| 26 | Ga0105248_10113545 | 3300009177 | Bacteria | 3055 |
| 27 | Ga0105246_10288468 | 3300011119 | Bacteria | 1320 |
| 28 | Ga0157374_10261118 | 3300013296 | Bacteria | 1706 |
| 29 | Ga0163163_10017518 | 3300014325 | Bacteria | 6683 |
| 30 | Ga0213872_10064759 | 3300021361 | Bacteria | 1651 |
| 31 | Ga0213875_10005765 | 3300021388 | Bacteria | 6594 |
| 32 | Ga0209130_1002380 | 3300025284 | Bacteria | 9531 |
| 33 | Ga0209675_1000682 | 3300025291 | Bacteria | 23696 |
| 34 | Ga0209025_1000456 | 3300025294 | Bacteria | 79848 |
| 35 | Ga0209025_1033725 | 3300025294 | Bacteria | 2358 |
| 36 | Ga0209758_1015787 | 3300025297 | Bacteria | 3884 |
| 37 | Ga0207426_1000088 | 3300025302 | Bacteria | 287526 |
| 38 | Ga0207692_10036056 | 3300025898 | Bacteria | 2408 |
| 39 | Ga0207684_10021702 | 3300025910 | Bacteria | 5482 |
| 40 | Ga0207646_10008157 | 3300025922 | Bacteria | 10536 |
| 41 | Ga0207659_10158036 | 3300025926 | Bacteria | 1777 |
| 42 | Ga0207700_10256474 | 3300025928 | Bacteria | 1496 |
| 43 | Ga0207644_10298649 | 3300025931 | Bacteria | 1297 |
| 44 | Ga0207706_10417740 | 3300025933 | Bacteria | 1162 |
| 45 | Ga0207669_10101009 | 3300025937 | Bacteria | 1907 |
| 46 | Ga0207651_10046768 | 3300025960 | Bacteria | 2913 |
| 47 | Ga0207702_10410911 | 3300026078 | Bacteria | 1307 |
| 48 | Ga0207675_100125569 | 3300026118 | Bacteria | 2430 |
| 49 | Ga0207428_10000120 | 3300027907 | Bacteria | 106231 |
| 50 | Ga0268266_10143746 | 3300028379 | Bacteria | 2143 |
| 51 | Ga0268266_10611030 | 3300028379 | Bacteria | 1048 |
| 52 | Ga0265336_10004874 | 3300028666 | Bacteria | 5027 |
| 53 | Ga0307515_10000601 | 3300028794 | Bacteria | 83966 |
| 54 | Ga0265338_10000761 | 3300028800 | Bacteria | 54973 |
| 55 | Ga0373926_0108060 | 3300035083 | Bacteria | 1044 |
| 56 | Ga0373955_0218369 | 3300035172 | Bacteria | 1138 |
| 57 | Ga0373961_0020690 | 3300035241 | Bacteria | 1743 |
| 58 | Ga0373935_0045531 | 3300035692 | Bacteria | 2769 |
| 59 | Ga0373933_0034628 | 3300035724 | Bacteria | 2944 |
| 60 | Ga0373947_0032533 | 3300035725 | Bacteria | 3074 |
| 61 | Ga0373937_0198169 | 3300036401 | Bacteria | 1887 |
| 62 | Ga0373925_0106949 | 3300037068 | Bacteria | 2157 |
| 63 | Ga0373925_0300789 | 3300037068 | Bacteria | 1295 |
| 64 | Ga0436364_0146374 | 3300037853 | Bacteria | 26321 |
| 65 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 66 | Ga0436364_1263278 | 3300037853 | Bacteria | 2154 |
| 67 | Ga0400487_49043 | 3300039110 | Bacteria | 1486 |
| 68 | Ga0436360_0850878 | 3300039438 | Bacteria | 999 |
| 69 | Ga0436360_1108419 | 3300039438 | Bacteria | 4084 |
| 70 | Ga0436361_0297642 | 3300039447 | Bacteria | 4600 |
| 71 | Ga0436361_0559693 | 3300039447 | Bacteria | 2367 |
| 72 | Ga0436361_0617230 | 3300039447 | Bacteria | 1554 |
| 73 | Ga0436361_1091033 | 3300039447 | Bacteria | 5123 |
| 74 | Ga0436361_1168766 | 3300039447 | Bacteria | 1254 |
| 75 | Ga0466963_0046249 | 3300044694 | Bacteria | 2869 |
| 76 | Ga0466971_0019203 | 3300044719 | Bacteria | 3034 |
| 77 | Ga0466958_0018131 | 3300045836 | Bacteria | 4079 |
| 78 | Ga0495638_0007286 | 3300046460 | Bacteria | 7951 |
| 79 | Ga0495651_0015862 | 3300046462 | Bacteria | 5834 |
| 80 | Ga0495628_0163609 | 3300046516 | Bacteria | 1690 |
| 81 | Ga0495587_0165599 | 3300046536 | Bacteria | 1257 |
| 82 | Ga0495635_0048206 | 3300046663 | Unclassified | 2937 |
| 83 | Ga0495599_0037845 | 3300046678 | Bacteria | 3031 |
| 84 | Ga0495680_0119375 | 3300047322 | Bacteria | 1948 |
| 85 | Ga0495675_0244289 | 3300047444 | Bacteria | 1080 |
| 86 | Ga0496111_0228644 | 3300048914 | Bacteria | 1382 |
| 87 | Ga0501033_0361673 | 3300049570 | Bacteria | 1015 |
| 88 | Ga0501034_0004340 | 3300049571 | Bacteria | 15803 |
| 89 | Ga0501034_0008483 | 3300049571 | Bacteria | 10853 |
| 90 | Ga0501034_0022470 | 3300049571 | Bacteria | 6428 |
| 91 | Ga0501037_0001883 | 3300049573 | Bacteria | 15250 |
| 92 | Ga0501047_0011963 | 3300049581 | Bacteria | 8212 |
| 93 | Ga0501047_0089104 | 3300049581 | Bacteria | 2963 |
| 94 | Ga0501070_0277773 | 3300049586 | Bacteria | 1367 |
| 95 | Ga0501072_0007635 | 3300049588 | Bacteria | 8210 |
| 96 | Ga0501073_0006944 | 3300049589 | Bacteria | 8427 |
| 97 | Ga0501080_0019587 | 3300049742 | Bacteria | 6269 |
| 98 | nmdc:mga09592_181118_c1 | 3300050508 | Bacteria | 1823 |
| 99 | nmdc:mga06r32_10079_c1 | 3300050510 | Bacteria | 8532 |
| 100 | nmdc:mga08y16_42_c1 | 3300050511 | Bacteria | 128353 |
| 101 | Ga0500568_0003023 | 3300053139 | Bacteria | 9625 |
| 102 | Ga0500616_0000223 | 3300053153 | Bacteria | 88492 |
| 103 | Ga0500596_005643 | 3300053735 | Bacteria | 2179 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0559693 | Ga0436361_0559693_1113_2087 | 283 |
| 2 | 3300035083 | Ga0373926_0108060 | Ga0373926_0108060_139_1014 | 286 |
| 3 | 3300035241 | Ga0373961_0020690 | Ga0373961_0020690_26_907 | 291 |
| 4 | 3300005456 | Ga0070678_100227744 | Ga0070678_1002277441 | 292 |
| 5 | 3300039438 | Ga0436360_0850878 | Ga0436360_0850878_14_925 | 292 |
| 6 | 3300005436 | Ga0070713_100269696 | Ga0070713_1002696962 | 294 |
| 7 | 3300025928 | Ga0207700_10256474 | Ga0207700_102564742 | 294 |
| 8 | 3300053153 | Ga0500616_0000223 | Ga0500616_0000223_10784_11761 | 295 |
| 9 | 3300005548 | Ga0070665_100066973 | Ga0070665_1000669734 | 298 |
| 10 | 3300035172 | Ga0373955_0218369 | Ga0373955_0218369_49_981 | 298 |
| 11 | 3300035692 | Ga0373935_0045531 | Ga0373935_0045531_412_1344 | 298 |
| 12 | 3300037068 | Ga0373925_0300789 | Ga0373925_0300789_71_1003 | 298 |
| 13 | 3300046536 | Ga0495587_0165599 | Ga0495587_0165599_283_1215 | 298 |
| 14 | 3300005356 | Ga0070674_100033106 | Ga0070674_1000331062 | 300 |
| 15 | 3300009098 | Ga0105245_10280885 | Ga0105245_102808851 | 300 |
| 16 | 3300025926 | Ga0207659_10158036 | Ga0207659_101580362 | 300 |
| 17 | 3300025937 | Ga0207669_10101009 | Ga0207669_101010092 | 300 |
| 18 | 3300049581 | Ga0501047_0011963 | Ga0501047_0011963_6338_7342 | 304 |
| 19 | 3300006847 | Ga0075431_100024741 | Ga0075431_1000247416 | 305 |
| 20 | 3300006880 | Ga0075429_100185405 | Ga0075429_1001854051 | 305 |
| 21 | 3300050508 | nmdc:mga09592_181118_c1 | nmdc:mga09592_181118_c1_95_1075 | 305 |
| 22 | 3300050510 | nmdc:mga06r32_10079_c1 | nmdc:mga06r32_10079_c1_6140_7120 | 305 |
| 23 | 3300039110 | Ga0400487_49043 | Ga0400487_49043_316_1239 | 306 |
| 24 | 3300005329 | Ga0070683_100206488 | Ga0070683_1002064882 | 307 |
| 25 | 3300006028 | Ga0070717_10214758 | Ga0070717_102147582 | 307 |
| 26 | 3300009177 | Ga0105248_10113545 | Ga0105248_101135454 | 307 |
| 27 | 3300011119 | Ga0105246_10288468 | Ga0105246_102884682 | 307 |
| 28 | 3300013296 | Ga0157374_10261118 | Ga0157374_102611182 | 307 |
| 29 | 3300014325 | Ga0163163_10017518 | Ga0163163_100175188 | 307 |
| 30 | 3300021388 | Ga0213875_10005765 | Ga0213875_100057653 | 307 |
| 31 | 3300026078 | Ga0207702_10410911 | Ga0207702_104109112 | 307 |
| 32 | 3300028379 | Ga0268266_10143746 | Ga0268266_101437461 | 307 |
| 33 | 3300035724 | Ga0373933_0034628 | Ga0373933_0034628_1845_2777 | 307 |
| 34 | 3300035725 | Ga0373947_0032533 | Ga0373947_0032533_1469_2401 | 307 |
| 35 | 3300036401 | Ga0373937_0198169 | Ga0373937_0198169_806_1738 | 307 |
| 36 | 3300037068 | Ga0373925_0106949 | Ga0373925_0106949_625_1557 | 307 |
| 37 | 3300037853 | Ga0436364_0146374 | Ga0436364_0146374_8998_9927 | 307 |
| 38 | 3300037853 | Ga0436364_0586291 | Ga0436364_0586291_74177_75124 | 307 |
| 39 | 3300039447 | Ga0436361_0297642 | Ga0436361_0297642_86_1060 | 307 |
| 40 | 3300046462 | Ga0495651_0015862 | Ga0495651_0015862_923_1855 | 307 |
| 41 | 3300046516 | Ga0495628_0163609 | Ga0495628_0163609_744_1676 | 307 |
| 42 | 3300046663 | Ga0495635_0048206 | Ga0495635_0048206_103_1050 | 307 |
| 43 | 3300046678 | Ga0495599_0037845 | Ga0495599_0037845_1413_2345 | 307 |
| 44 | 3300047322 | Ga0495680_0119375 | Ga0495680_0119375_268_1200 | 307 |
| 45 | 3300047444 | Ga0495675_0244289 | Ga0495675_0244289_106_1038 | 307 |
| 46 | iso_pu_bacteria | 2932401849 | 2932405929 | 307 |
| 47 | 3300005437 | Ga0070710_10051434 | Ga0070710_100514342 | 308 |
| 48 | 3300005438 | Ga0070701_10104161 | Ga0070701_101041612 | 308 |
| 49 | 3300005440 | Ga0070705_100124572 | Ga0070705_1001245721 | 308 |
| 50 | 3300005445 | Ga0070708_100003906 | Ga0070708_1000039067 | 308 |
| 51 | 3300005468 | Ga0070707_100001270 | Ga0070707_1000012708 | 308 |
| 52 | 3300005471 | Ga0070698_100000011 | Ga0070698_10000001129 | 308 |
| 53 | 3300005471 | Ga0070698_100001295 | Ga0070698_1000012958 | 308 |
| 54 | 3300005518 | Ga0070699_100085945 | Ga0070699_1000859451 | 308 |
| 55 | 3300005546 | Ga0070696_100032609 | Ga0070696_1000326093 | 308 |
| 56 | 3300006028 | Ga0070717_10004263 | Ga0070717_100042633 | 308 |
| 57 | 3300009094 | Ga0111539_10000096 | Ga0111539_1000009613 | 308 |
| 58 | 3300025291 | Ga0209675_1000682 | Ga0209675_10006822 | 308 |
| 59 | 3300025898 | Ga0207692_10036056 | Ga0207692_100360562 | 308 |
| 60 | 3300025910 | Ga0207684_10021702 | Ga0207684_100217022 | 308 |
| 61 | 3300025922 | Ga0207646_10008157 | Ga0207646_100081574 | 308 |
| 62 | 3300025933 | Ga0207706_10417740 | Ga0207706_104177401 | 308 |
| 63 | 3300025960 | Ga0207651_10046768 | Ga0207651_100467682 | 308 |
| 64 | 3300026118 | Ga0207675_100125569 | Ga0207675_1001255691 | 308 |
| 65 | 3300027907 | Ga0207428_10000120 | Ga0207428_1000012083 | 308 |
| 66 | 3300028666 | Ga0265336_10004874 | Ga0265336_100048744 | 308 |
| 67 | 3300028800 | Ga0265338_10000761 | Ga0265338_1000076129 | 308 |
| 68 | 3300037853 | Ga0436364_1263278 | Ga0436364_1263278_623_1582 | 308 |
| 69 | 3300044719 | Ga0466971_0019203 | Ga0466971_0019203_1592_2521 | 308 |
| 70 | 3300045836 | Ga0466958_0018131 | Ga0466958_0018131_718_1647 | 308 |
| 71 | 3300048914 | Ga0496111_0228644 | Ga0496111_0228644_420_1361 | 308 |
| 72 | 3300050511 | nmdc:mga08y16_42_c1 | nmdc:mga08y16_42_c1_55833_56786 | 308 |
| 73 | 3300053139 | Ga0500568_0003023 | Ga0500568_0003023_7173_8117 | 308 |
| 74 | 3300053735 | Ga0500596_005643 | Ga0500596_005643_1236_2165 | 308 |
| 75 | iso_pu_bacteria | 2510065059 | 2510319172 | 308 |
| 76 | iso_pu_bacteria | 2513237164 | 2514038480 | 308 |
| 77 | iso_pu_bacteria | 2599185301 | 2599939050 | 308 |
| 78 | iso_pu_bacteria | 2687453392 | 2688596867 | 308 |
| 79 | iso_pu_bacteria | 2756170246 | 2756677402 | 308 |
| 80 | iso_pu_bacteria | 2791355123 | 2792748383 | 308 |
| 81 | iso_pu_bacteria | 2841734538 | 2841737360 | 308 |
| 82 | iso_pu_bacteria | 2844002411 | 2844009107 | 308 |
| 83 | iso_pu_bacteria | 2847670302 | 2847674628 | 308 |
| 84 | iso_pu_bacteria | 2856314179 | 2856317486 | 308 |
| 85 | iso_pu_bacteria | 2856328259 | 2856328831 | 308 |
| 86 | iso_pu_bacteria | 2856334872 | 2856336751 | 308 |
| 87 | iso_pu_bacteria | 2869264136 | 2869265388 | 308 |
| 88 | iso_pu_bacteria | 2871451962 | 2871454062 | 308 |
| 89 | iso_pu_bacteria | 2871459585 | 2871465972 | 308 |
| 90 | iso_pu_bacteria | 2871466892 | 2871471662 | 308 |
| 91 | iso_pu_bacteria | 2871474448 | 2871478894 | 308 |
| 92 | iso_pu_bacteria | 2874109183 | 2874112045 | 308 |
| 93 | iso_pu_bacteria | 2874162495 | 2874167623 | 308 |
| 94 | iso_pu_bacteria | 2874168670 | 2874175672 | 308 |
| 95 | iso_pu_bacteria | 2876399893 | 2876404716 | 308 |
| 96 | iso_pu_bacteria | 2878035449 | 2878038524 | 308 |
| 97 | iso_pu_bacteria | 2878730984 | 2878736868 | 308 |
| 98 | iso_pu_bacteria | 2878753008 | 2878754452 | 308 |
| 99 | iso_pu_bacteria | 2878774303 | 2878778482 | 308 |
| 100 | iso_pu_bacteria | 2878781027 | 2878786188 | 308 |
| 101 | iso_pu_bacteria | 2881155292 | 2881160646 | 308 |
| 102 | iso_pu_bacteria | 2881845957 | 2881852687 | 308 |
| 103 | iso_pu_bacteria | 2882632389 | 2882634112 | 308 |
| 104 | iso_pu_bacteria | 2882912400 | 2882918658 | 308 |
| 105 | iso_pu_bacteria | 2885318864 | 2885323587 | 308 |
| 106 | iso_pu_bacteria | 2885350715 | 2885351208 | 308 |
| 107 | iso_pu_bacteria | 2903492973 | 2903497657 | 308 |
| 108 | iso_pu_bacteria | 2903513507 | 2903517682 | 308 |
| 109 | iso_pu_bacteria | 2906363423 | 2906365528 | 308 |
| 110 | iso_pu_bacteria | 2906370794 | 2906373243 | 308 |
| 111 | iso_pu_bacteria | 2906408224 | 2906411380 | 308 |
| 112 | iso_pu_bacteria | 2906414383 | 2906417551 | 308 |
| 113 | iso_pu_bacteria | 2922151315 | 2922155139 | 308 |
| 114 | iso_pu_bacteria | 2922158528 | 2922162439 | 308 |
| 115 | iso_pu_bacteria | 2922172374 | 2922173344 | 308 |
| 116 | iso_pu_bacteria | 2924710171 | 2924710187 | 308 |
| 117 | iso_pu_bacteria | 2924726620 | 2924730481 | 308 |
| 118 | iso_pu_bacteria | 2924748358 | 2924753227 | 308 |
| 119 | iso_pu_bacteria | 2924784321 | 2924790160 | 308 |
| 120 | iso_pu_bacteria | 2937836603 | 2937840710 | 308 |
| 121 | iso_pu_bacteria | 2958071322 | 2958073657 | 308 |
| 122 | iso_pu_bacteria | 2958122699 | 2958130135 | 308 |
| 123 | iso_pu_bacteria | 2958137437 | 2958141738 | 308 |
| 124 | iso_pu_bacteria | 2961136820 | 2961141360 | 308 |
| 125 | iso_pu_bacteria | 2961170736 | 2961171882 | 308 |
| 126 | iso_pu_bacteria | 2965025482 | 2965025695 | 308 |
| 127 | iso_pu_bacteria | 2965032056 | 2965033130 | 308 |
| 128 | iso_pu_bacteria | 2965040258 | 2965043734 | 308 |
| 129 | iso_pu_bacteria | 2965047637 | 2965054029 | 308 |
| 130 | iso_pu_bacteria | 2965089291 | 2965089734 | 308 |
| 131 | iso_pu_bacteria | 2967996073 | 2967996989 | 308 |
| 132 | iso_pu_bacteria | 2968003550 | 2968005050 | 308 |
| 133 | iso_pu_bacteria | 2970489779 | 2970490532 | 308 |
| 134 | iso_pu_bacteria | 2970503327 | 2970504480 | 308 |
| 135 | iso_pu_bacteria | 2970547951 | 2970552775 | 308 |
| 136 | iso_pu_bacteria | 2977821940 | 2977823669 | 308 |
| 137 | iso_pu_bacteria | 2977828996 | 2977835779 | 308 |
| 138 | iso_pu_bacteria | 2977872689 | 2977879843 | 308 |
| 139 | iso_pu_bacteria | 2977915119 | 2977920006 | 308 |
| 140 | iso_pu_bacteria | 2977935797 | 2977940542 | 308 |
| 141 | iso_pu_bacteria | 2977950692 | 2977956636 | 308 |
| 142 | iso_pu_bacteria | 2977957713 | 2977958841 | 308 |
| 143 | iso_pu_bacteria | 2979793036 | 2979798318 | 308 |
| 144 | iso_pu_bacteria | 2979808191 | 2979809117 | 308 |
| 145 | iso_pu_bacteria | 2987645492 | 2987651802 | 308 |
| 146 | iso_pu_bacteria | 2996341866 | 2996347842 | 308 |
| 147 | iso_pu_bacteria | 3004239961 | 3004246134 | 308 |
| 148 | iso_pu_bacteria | 649633066 | 649871426 | 308 |
| 149 | iso_pu_bacteria | 8004361976 | 8004362824 | 308 |
| 150 | iso_pu_bacteria | 8004374579 | 8004376028 | 308 |
| 151 | iso_pu_bacteria | 8004633249 | 8004636747 | 308 |
| 152 | 3300005355 | Ga0070671_100011170 | Ga0070671_1000111702 | 309 |
| 153 | 3300009093 | Ga0105240_10358089 | Ga0105240_103580892 | 309 |
| 154 | 3300025931 | Ga0207644_10298649 | Ga0207644_102986491 | 309 |
| 155 | 3300049570 | Ga0501033_0361673 | Ga0501033_0361673_13_963 | 309 |
| 156 | 3300049573 | Ga0501037_0001883 | Ga0501037_0001883_13442_14392 | 309 |
| 157 | 3300046460 | Ga0495638_0007286 | Ga0495638_0007286_3789_4724 | 311 |
| 158 | 3300028794 | Ga0307515_10000601 | Ga0307515_1000060145 | 312 |
| 159 | 3300049571 | Ga0501034_0004340 | Ga0501034_0004340_6068_7057 | 312 |
| 160 | 3300049571 | Ga0501034_0008483 | Ga0501034_0008483_2805_3746 | 312 |
| 161 | 3300049571 | Ga0501034_0022470 | Ga0501034_0022470_531_1520 | 312 |
| 162 | 3300049581 | Ga0501047_0089104 | Ga0501047_0089104_682_1623 | 312 |
| 163 | 3300049586 | Ga0501070_0277773 | Ga0501070_0277773_316_1257 | 312 |
| 164 | 3300049588 | Ga0501072_0007635 | Ga0501072_0007635_1697_2686 | 312 |
| 165 | 3300049589 | Ga0501073_0006944 | Ga0501073_0006944_555_1496 | 312 |
| 166 | 3300049742 | Ga0501080_0019587 | Ga0501080_0019587_65_1006 | 312 |
| 167 | 3300003187 | JGI25151J46595_10001605 | JGI25151J46595_100016057 | 313 |
| 168 | 3300003354 | JGI25160J50197_1004393 | JGI25160J50197_10043934 | 313 |
| 169 | 3300005548 | Ga0070665_100567277 | Ga0070665_1005672772 | 313 |
| 170 | 3300021361 | Ga0213872_10064759 | Ga0213872_100647592 | 313 |
| 171 | 3300025284 | Ga0209130_1002380 | Ga0209130_10023807 | 313 |
| 172 | 3300025294 | Ga0209025_1000456 | Ga0209025_100045645 | 313 |
| 173 | 3300025294 | Ga0209025_1033725 | Ga0209025_10337252 | 313 |
| 174 | 3300025297 | Ga0209758_1015787 | Ga0209758_10157873 | 313 |
| 175 | 3300025302 | Ga0207426_1000088 | Ga0207426_1000088222 | 313 |
| 176 | 3300028379 | Ga0268266_10611030 | Ga0268266_106110301 | 313 |
| 177 | 3300039438 | Ga0436360_1108419 | Ga0436360_1108419_728_1672 | 313 |
| 178 | 3300039447 | Ga0436361_0617230 | Ga0436361_0617230_565_1509 | 313 |
| 179 | 3300039447 | Ga0436361_1091033 | Ga0436361_1091033_822_1769 | 313 |
| 180 | 3300039447 | Ga0436361_1168766 | Ga0436361_1168766_224_1198 | 313 |
| 181 | 3300044694 | Ga0466963_0046249 | Ga0466963_0046249_96_1043 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gn2-assembly1.cif.gz_A | crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) | 0.9429 | 2 | 306 |
| 5cvc-assembly2.cif.gz_B-2 | structure of maize serine racemase | 0.9408 | 3 | 307 |
| 6zsp-assembly1.cif.gz_BBB | human serine racemase bound to atp and malonate. | 0.9353 | 2 | 306 |
| 3l6r-assembly1.cif.gz_A-2 | the structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding | 0.9345 | 2 | 306 |
| 6zsp-assembly1.cif.gz_AAA | human serine racemase bound to atp and malonate. | 0.9337 | 3 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VHF0_106_202_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9664 | 52 | 143 | 3.40.50.1100 |
| af_Q2FWJ9_55_154_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9629 | 52 | 147 | 3.40.50.1100 |
| 4d9gB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9511 | 72 | 143 | 3.40.50.1100 |
| af_P36007_52_148_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9468 | 52 | 147 | 3.40.50.1100 |
| af_P9WG95_65_164_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.945 | 52 | 147 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4SR38-F1-model_v4 | Serine/threonine dehydratase | 0.9825 | 110 | 312 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A7V8FN82-F1-model_v4 | Phenylserine dehydratase | 0.9757 | 145 | 312 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A2W4QRT5-F1-model_v4 | Serine/threonine dehydratase | 0.9738 | 1 | 264 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 GO:0030170 |
| AF-K1U779-F1-model_v4 | Threonine ammonia-lyase | 0.9738 | 168 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A535R5A4-F1-model_v4 | Threonine/serine dehydratase | 0.9735 | 3 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar