F277315

General Info

Members Datasets Scaffolds Average Seq Length
181 165 103 312

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10113545|Ga0105248_101135454
Length 358
Sequence MNAVNDTPSPVRLAQLPWICMGRQSGPGCGGKKAHLVASQGKCQRRFVMISRNNIAAAAARIGGHVRHTPVIRLNSIDCEMNLPVTLKLELLQHTGSFKPRGAFNRLLSASVPGAGVIAASGGNHGAAVAYAARILGVSAEIFVPCTTPATKVARIKSYGARVVQAGANYAEALAACRDRQAETGALEVHAYDHPDVLAGQGTVGREFEQDAPELTHLLVATGGGGLIGGIAAWYASSAEVVSVEPKSCPTLHDALRAGHPVDAQVGGLAADSLGARQVGSLMFPIAQAHVAASVLVPDAAIAQAQRLLWDRLRLVAEPGGATALAALLCGAFEAPAHAQVGVLVCGANTDPSKVADA

Samples

Sample ID Description Type Environment
1 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
2 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
3 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
4 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
5 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
6 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
7 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
8 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
9 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
10 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
11 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
12 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
13 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
14 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
15 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
16 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
17 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
18 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
19 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
20 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
21 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
22 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
23 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
24 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
25 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
26 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
27 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
28 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
29 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
30 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
31 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
32 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
33 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
34 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
35 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
36 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
37 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
38 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
39 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
40 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
41 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
42 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
43 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
44 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
45 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
46 2932401849 Devosia sp. 2618 Isolate Rhizosphere
47 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
48 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
49 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
50 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
51 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
52 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
53 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
54 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
55 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
56 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
57 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
58 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
59 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
60 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
61 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
62 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
63 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
64 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
65 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
66 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
67 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
68 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
69 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
70 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
71 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
72 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
73 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
74 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
162 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
163 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
164 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
165 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.91
Metatranscriptomes 0
Isolates 43.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 40.33
Rhizoplane 1.1
Rhizosphere 47.51
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001605 3300003187 Bacteria 14988
2 JGI25160J50197_1004393 3300003354 Bacteria 6106
3 Ga0070683_100206488 3300005329 Bacteria 1866
4 Ga0070671_100011170 3300005355 Bacteria 7211
5 Ga0070674_100033106 3300005356 Bacteria 3438
6 Ga0070713_100269696 3300005436 Bacteria 1558
7 Ga0070710_10051434 3300005437 Bacteria 2313
8 Ga0070701_10104161 3300005438 Bacteria 1576
9 Ga0070705_100124572 3300005440 Bacteria 1670
10 Ga0070708_100003906 3300005445 Bacteria 11701
11 Ga0070678_100227744 3300005456 Bacteria 1552
12 Ga0070707_100001270 3300005468 Bacteria 24819
13 Ga0070698_100000011 3300005471 Bacteria 116801
14 Ga0070698_100001295 3300005471 Bacteria 27867
15 Ga0070699_100085945 3300005518 Bacteria 2745
16 Ga0070696_100032609 3300005546 Bacteria 3574
17 Ga0070665_100066973 3300005548 Bacteria 3602
18 Ga0070665_100567277 3300005548 Bacteria 1148
19 Ga0070717_10004263 3300006028 Bacteria 10308
20 Ga0070717_10214758 3300006028 Bacteria 1689
21 Ga0075431_100024741 3300006847 Bacteria 6156
22 Ga0075429_100185405 3300006880 Bacteria 1823
23 Ga0105240_10358089 3300009093 Bacteria 1654
24 Ga0111539_10000096 3300009094 Bacteria 92188
25 Ga0105245_10280885 3300009098 Bacteria 1627
26 Ga0105248_10113545 3300009177 Bacteria 3055
27 Ga0105246_10288468 3300011119 Bacteria 1320
28 Ga0157374_10261118 3300013296 Bacteria 1706
29 Ga0163163_10017518 3300014325 Bacteria 6683
30 Ga0213872_10064759 3300021361 Bacteria 1651
31 Ga0213875_10005765 3300021388 Bacteria 6594
32 Ga0209130_1002380 3300025284 Bacteria 9531
33 Ga0209675_1000682 3300025291 Bacteria 23696
34 Ga0209025_1000456 3300025294 Bacteria 79848
35 Ga0209025_1033725 3300025294 Bacteria 2358
36 Ga0209758_1015787 3300025297 Bacteria 3884
37 Ga0207426_1000088 3300025302 Bacteria 287526
38 Ga0207692_10036056 3300025898 Bacteria 2408
39 Ga0207684_10021702 3300025910 Bacteria 5482
40 Ga0207646_10008157 3300025922 Bacteria 10536
41 Ga0207659_10158036 3300025926 Bacteria 1777
42 Ga0207700_10256474 3300025928 Bacteria 1496
43 Ga0207644_10298649 3300025931 Bacteria 1297
44 Ga0207706_10417740 3300025933 Bacteria 1162
45 Ga0207669_10101009 3300025937 Bacteria 1907
46 Ga0207651_10046768 3300025960 Bacteria 2913
47 Ga0207702_10410911 3300026078 Bacteria 1307
48 Ga0207675_100125569 3300026118 Bacteria 2430
49 Ga0207428_10000120 3300027907 Bacteria 106231
50 Ga0268266_10143746 3300028379 Bacteria 2143
51 Ga0268266_10611030 3300028379 Bacteria 1048
52 Ga0265336_10004874 3300028666 Bacteria 5027
53 Ga0307515_10000601 3300028794 Bacteria 83966
54 Ga0265338_10000761 3300028800 Bacteria 54973
55 Ga0373926_0108060 3300035083 Bacteria 1044
56 Ga0373955_0218369 3300035172 Bacteria 1138
57 Ga0373961_0020690 3300035241 Bacteria 1743
58 Ga0373935_0045531 3300035692 Bacteria 2769
59 Ga0373933_0034628 3300035724 Bacteria 2944
60 Ga0373947_0032533 3300035725 Bacteria 3074
61 Ga0373937_0198169 3300036401 Bacteria 1887
62 Ga0373925_0106949 3300037068 Bacteria 2157
63 Ga0373925_0300789 3300037068 Bacteria 1295
64 Ga0436364_0146374 3300037853 Bacteria 26321
65 Ga0436364_0586291 3300037853 Bacteria 97560
66 Ga0436364_1263278 3300037853 Bacteria 2154
67 Ga0400487_49043 3300039110 Bacteria 1486
68 Ga0436360_0850878 3300039438 Bacteria 999
69 Ga0436360_1108419 3300039438 Bacteria 4084
70 Ga0436361_0297642 3300039447 Bacteria 4600
71 Ga0436361_0559693 3300039447 Bacteria 2367
72 Ga0436361_0617230 3300039447 Bacteria 1554
73 Ga0436361_1091033 3300039447 Bacteria 5123
74 Ga0436361_1168766 3300039447 Bacteria 1254
75 Ga0466963_0046249 3300044694 Bacteria 2869
76 Ga0466971_0019203 3300044719 Bacteria 3034
77 Ga0466958_0018131 3300045836 Bacteria 4079
78 Ga0495638_0007286 3300046460 Bacteria 7951
79 Ga0495651_0015862 3300046462 Bacteria 5834
80 Ga0495628_0163609 3300046516 Bacteria 1690
81 Ga0495587_0165599 3300046536 Bacteria 1257
82 Ga0495635_0048206 3300046663 Unclassified 2937
83 Ga0495599_0037845 3300046678 Bacteria 3031
84 Ga0495680_0119375 3300047322 Bacteria 1948
85 Ga0495675_0244289 3300047444 Bacteria 1080
86 Ga0496111_0228644 3300048914 Bacteria 1382
87 Ga0501033_0361673 3300049570 Bacteria 1015
88 Ga0501034_0004340 3300049571 Bacteria 15803
89 Ga0501034_0008483 3300049571 Bacteria 10853
90 Ga0501034_0022470 3300049571 Bacteria 6428
91 Ga0501037_0001883 3300049573 Bacteria 15250
92 Ga0501047_0011963 3300049581 Bacteria 8212
93 Ga0501047_0089104 3300049581 Bacteria 2963
94 Ga0501070_0277773 3300049586 Bacteria 1367
95 Ga0501072_0007635 3300049588 Bacteria 8210
96 Ga0501073_0006944 3300049589 Bacteria 8427
97 Ga0501080_0019587 3300049742 Bacteria 6269
98 nmdc:mga09592_181118_c1 3300050508 Bacteria 1823
99 nmdc:mga06r32_10079_c1 3300050510 Bacteria 8532
100 nmdc:mga08y16_42_c1 3300050511 Bacteria 128353
101 Ga0500568_0003023 3300053139 Bacteria 9625
102 Ga0500616_0000223 3300053153 Bacteria 88492
103 Ga0500596_005643 3300053735 Bacteria 2179

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0559693 Ga0436361_0559693_1113_2087 283
2 3300035083 Ga0373926_0108060 Ga0373926_0108060_139_1014 286
3 3300035241 Ga0373961_0020690 Ga0373961_0020690_26_907 291
4 3300005456 Ga0070678_100227744 Ga0070678_1002277441 292
5 3300039438 Ga0436360_0850878 Ga0436360_0850878_14_925 292
6 3300005436 Ga0070713_100269696 Ga0070713_1002696962 294
7 3300025928 Ga0207700_10256474 Ga0207700_102564742 294
8 3300053153 Ga0500616_0000223 Ga0500616_0000223_10784_11761 295
9 3300005548 Ga0070665_100066973 Ga0070665_1000669734 298
10 3300035172 Ga0373955_0218369 Ga0373955_0218369_49_981 298
11 3300035692 Ga0373935_0045531 Ga0373935_0045531_412_1344 298
12 3300037068 Ga0373925_0300789 Ga0373925_0300789_71_1003 298
13 3300046536 Ga0495587_0165599 Ga0495587_0165599_283_1215 298
14 3300005356 Ga0070674_100033106 Ga0070674_1000331062 300
15 3300009098 Ga0105245_10280885 Ga0105245_102808851 300
16 3300025926 Ga0207659_10158036 Ga0207659_101580362 300
17 3300025937 Ga0207669_10101009 Ga0207669_101010092 300
18 3300049581 Ga0501047_0011963 Ga0501047_0011963_6338_7342 304
19 3300006847 Ga0075431_100024741 Ga0075431_1000247416 305
20 3300006880 Ga0075429_100185405 Ga0075429_1001854051 305
21 3300050508 nmdc:mga09592_181118_c1 nmdc:mga09592_181118_c1_95_1075 305
22 3300050510 nmdc:mga06r32_10079_c1 nmdc:mga06r32_10079_c1_6140_7120 305
23 3300039110 Ga0400487_49043 Ga0400487_49043_316_1239 306
24 3300005329 Ga0070683_100206488 Ga0070683_1002064882 307
25 3300006028 Ga0070717_10214758 Ga0070717_102147582 307
26 3300009177 Ga0105248_10113545 Ga0105248_101135454 307
27 3300011119 Ga0105246_10288468 Ga0105246_102884682 307
28 3300013296 Ga0157374_10261118 Ga0157374_102611182 307
29 3300014325 Ga0163163_10017518 Ga0163163_100175188 307
30 3300021388 Ga0213875_10005765 Ga0213875_100057653 307
31 3300026078 Ga0207702_10410911 Ga0207702_104109112 307
32 3300028379 Ga0268266_10143746 Ga0268266_101437461 307
33 3300035724 Ga0373933_0034628 Ga0373933_0034628_1845_2777 307
34 3300035725 Ga0373947_0032533 Ga0373947_0032533_1469_2401 307
35 3300036401 Ga0373937_0198169 Ga0373937_0198169_806_1738 307
36 3300037068 Ga0373925_0106949 Ga0373925_0106949_625_1557 307
37 3300037853 Ga0436364_0146374 Ga0436364_0146374_8998_9927 307
38 3300037853 Ga0436364_0586291 Ga0436364_0586291_74177_75124 307
39 3300039447 Ga0436361_0297642 Ga0436361_0297642_86_1060 307
40 3300046462 Ga0495651_0015862 Ga0495651_0015862_923_1855 307
41 3300046516 Ga0495628_0163609 Ga0495628_0163609_744_1676 307
42 3300046663 Ga0495635_0048206 Ga0495635_0048206_103_1050 307
43 3300046678 Ga0495599_0037845 Ga0495599_0037845_1413_2345 307
44 3300047322 Ga0495680_0119375 Ga0495680_0119375_268_1200 307
45 3300047444 Ga0495675_0244289 Ga0495675_0244289_106_1038 307
46 iso_pu_bacteria 2932401849 2932405929 307
47 3300005437 Ga0070710_10051434 Ga0070710_100514342 308
48 3300005438 Ga0070701_10104161 Ga0070701_101041612 308
49 3300005440 Ga0070705_100124572 Ga0070705_1001245721 308
50 3300005445 Ga0070708_100003906 Ga0070708_1000039067 308
51 3300005468 Ga0070707_100001270 Ga0070707_1000012708 308
52 3300005471 Ga0070698_100000011 Ga0070698_10000001129 308
53 3300005471 Ga0070698_100001295 Ga0070698_1000012958 308
54 3300005518 Ga0070699_100085945 Ga0070699_1000859451 308
55 3300005546 Ga0070696_100032609 Ga0070696_1000326093 308
56 3300006028 Ga0070717_10004263 Ga0070717_100042633 308
57 3300009094 Ga0111539_10000096 Ga0111539_1000009613 308
58 3300025291 Ga0209675_1000682 Ga0209675_10006822 308
59 3300025898 Ga0207692_10036056 Ga0207692_100360562 308
60 3300025910 Ga0207684_10021702 Ga0207684_100217022 308
61 3300025922 Ga0207646_10008157 Ga0207646_100081574 308
62 3300025933 Ga0207706_10417740 Ga0207706_104177401 308
63 3300025960 Ga0207651_10046768 Ga0207651_100467682 308
64 3300026118 Ga0207675_100125569 Ga0207675_1001255691 308
65 3300027907 Ga0207428_10000120 Ga0207428_1000012083 308
66 3300028666 Ga0265336_10004874 Ga0265336_100048744 308
67 3300028800 Ga0265338_10000761 Ga0265338_1000076129 308
68 3300037853 Ga0436364_1263278 Ga0436364_1263278_623_1582 308
69 3300044719 Ga0466971_0019203 Ga0466971_0019203_1592_2521 308
70 3300045836 Ga0466958_0018131 Ga0466958_0018131_718_1647 308
71 3300048914 Ga0496111_0228644 Ga0496111_0228644_420_1361 308
72 3300050511 nmdc:mga08y16_42_c1 nmdc:mga08y16_42_c1_55833_56786 308
73 3300053139 Ga0500568_0003023 Ga0500568_0003023_7173_8117 308
74 3300053735 Ga0500596_005643 Ga0500596_005643_1236_2165 308
75 iso_pu_bacteria 2510065059 2510319172 308
76 iso_pu_bacteria 2513237164 2514038480 308
77 iso_pu_bacteria 2599185301 2599939050 308
78 iso_pu_bacteria 2687453392 2688596867 308
79 iso_pu_bacteria 2756170246 2756677402 308
80 iso_pu_bacteria 2791355123 2792748383 308
81 iso_pu_bacteria 2841734538 2841737360 308
82 iso_pu_bacteria 2844002411 2844009107 308
83 iso_pu_bacteria 2847670302 2847674628 308
84 iso_pu_bacteria 2856314179 2856317486 308
85 iso_pu_bacteria 2856328259 2856328831 308
86 iso_pu_bacteria 2856334872 2856336751 308
87 iso_pu_bacteria 2869264136 2869265388 308
88 iso_pu_bacteria 2871451962 2871454062 308
89 iso_pu_bacteria 2871459585 2871465972 308
90 iso_pu_bacteria 2871466892 2871471662 308
91 iso_pu_bacteria 2871474448 2871478894 308
92 iso_pu_bacteria 2874109183 2874112045 308
93 iso_pu_bacteria 2874162495 2874167623 308
94 iso_pu_bacteria 2874168670 2874175672 308
95 iso_pu_bacteria 2876399893 2876404716 308
96 iso_pu_bacteria 2878035449 2878038524 308
97 iso_pu_bacteria 2878730984 2878736868 308
98 iso_pu_bacteria 2878753008 2878754452 308
99 iso_pu_bacteria 2878774303 2878778482 308
100 iso_pu_bacteria 2878781027 2878786188 308
101 iso_pu_bacteria 2881155292 2881160646 308
102 iso_pu_bacteria 2881845957 2881852687 308
103 iso_pu_bacteria 2882632389 2882634112 308
104 iso_pu_bacteria 2882912400 2882918658 308
105 iso_pu_bacteria 2885318864 2885323587 308
106 iso_pu_bacteria 2885350715 2885351208 308
107 iso_pu_bacteria 2903492973 2903497657 308
108 iso_pu_bacteria 2903513507 2903517682 308
109 iso_pu_bacteria 2906363423 2906365528 308
110 iso_pu_bacteria 2906370794 2906373243 308
111 iso_pu_bacteria 2906408224 2906411380 308
112 iso_pu_bacteria 2906414383 2906417551 308
113 iso_pu_bacteria 2922151315 2922155139 308
114 iso_pu_bacteria 2922158528 2922162439 308
115 iso_pu_bacteria 2922172374 2922173344 308
116 iso_pu_bacteria 2924710171 2924710187 308
117 iso_pu_bacteria 2924726620 2924730481 308
118 iso_pu_bacteria 2924748358 2924753227 308
119 iso_pu_bacteria 2924784321 2924790160 308
120 iso_pu_bacteria 2937836603 2937840710 308
121 iso_pu_bacteria 2958071322 2958073657 308
122 iso_pu_bacteria 2958122699 2958130135 308
123 iso_pu_bacteria 2958137437 2958141738 308
124 iso_pu_bacteria 2961136820 2961141360 308
125 iso_pu_bacteria 2961170736 2961171882 308
126 iso_pu_bacteria 2965025482 2965025695 308
127 iso_pu_bacteria 2965032056 2965033130 308
128 iso_pu_bacteria 2965040258 2965043734 308
129 iso_pu_bacteria 2965047637 2965054029 308
130 iso_pu_bacteria 2965089291 2965089734 308
131 iso_pu_bacteria 2967996073 2967996989 308
132 iso_pu_bacteria 2968003550 2968005050 308
133 iso_pu_bacteria 2970489779 2970490532 308
134 iso_pu_bacteria 2970503327 2970504480 308
135 iso_pu_bacteria 2970547951 2970552775 308
136 iso_pu_bacteria 2977821940 2977823669 308
137 iso_pu_bacteria 2977828996 2977835779 308
138 iso_pu_bacteria 2977872689 2977879843 308
139 iso_pu_bacteria 2977915119 2977920006 308
140 iso_pu_bacteria 2977935797 2977940542 308
141 iso_pu_bacteria 2977950692 2977956636 308
142 iso_pu_bacteria 2977957713 2977958841 308
143 iso_pu_bacteria 2979793036 2979798318 308
144 iso_pu_bacteria 2979808191 2979809117 308
145 iso_pu_bacteria 2987645492 2987651802 308
146 iso_pu_bacteria 2996341866 2996347842 308
147 iso_pu_bacteria 3004239961 3004246134 308
148 iso_pu_bacteria 649633066 649871426 308
149 iso_pu_bacteria 8004361976 8004362824 308
150 iso_pu_bacteria 8004374579 8004376028 308
151 iso_pu_bacteria 8004633249 8004636747 308
152 3300005355 Ga0070671_100011170 Ga0070671_1000111702 309
153 3300009093 Ga0105240_10358089 Ga0105240_103580892 309
154 3300025931 Ga0207644_10298649 Ga0207644_102986491 309
155 3300049570 Ga0501033_0361673 Ga0501033_0361673_13_963 309
156 3300049573 Ga0501037_0001883 Ga0501037_0001883_13442_14392 309
157 3300046460 Ga0495638_0007286 Ga0495638_0007286_3789_4724 311
158 3300028794 Ga0307515_10000601 Ga0307515_1000060145 312
159 3300049571 Ga0501034_0004340 Ga0501034_0004340_6068_7057 312
160 3300049571 Ga0501034_0008483 Ga0501034_0008483_2805_3746 312
161 3300049571 Ga0501034_0022470 Ga0501034_0022470_531_1520 312
162 3300049581 Ga0501047_0089104 Ga0501047_0089104_682_1623 312
163 3300049586 Ga0501070_0277773 Ga0501070_0277773_316_1257 312
164 3300049588 Ga0501072_0007635 Ga0501072_0007635_1697_2686 312
165 3300049589 Ga0501073_0006944 Ga0501073_0006944_555_1496 312
166 3300049742 Ga0501080_0019587 Ga0501080_0019587_65_1006 312
167 3300003187 JGI25151J46595_10001605 JGI25151J46595_100016057 313
168 3300003354 JGI25160J50197_1004393 JGI25160J50197_10043934 313
169 3300005548 Ga0070665_100567277 Ga0070665_1005672772 313
170 3300021361 Ga0213872_10064759 Ga0213872_100647592 313
171 3300025284 Ga0209130_1002380 Ga0209130_10023807 313
172 3300025294 Ga0209025_1000456 Ga0209025_100045645 313
173 3300025294 Ga0209025_1033725 Ga0209025_10337252 313
174 3300025297 Ga0209758_1015787 Ga0209758_10157873 313
175 3300025302 Ga0207426_1000088 Ga0207426_1000088222 313
176 3300028379 Ga0268266_10611030 Ga0268266_106110301 313
177 3300039438 Ga0436360_1108419 Ga0436360_1108419_728_1672 313
178 3300039447 Ga0436361_0617230 Ga0436361_0617230_565_1509 313
179 3300039447 Ga0436361_1091033 Ga0436361_1091033_822_1769 313
180 3300039447 Ga0436361_1168766 Ga0436361_1168766_224_1198 313
181 3300044694 Ga0466963_0046249 Ga0466963_0046249_96_1043 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

62

347

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9429 2 306
5cvc-assembly2.cif.gz_B-2 structure of maize serine racemase 0.9408 3 307
6zsp-assembly1.cif.gz_BBB human serine racemase bound to atp and malonate. 0.9353 2 306
3l6r-assembly1.cif.gz_A-2 the structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding 0.9345 2 306
6zsp-assembly1.cif.gz_AAA human serine racemase bound to atp and malonate. 0.9337 3 306
ID Description Score Start End Superfamily
af_Q9VHF0_106_202_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9664 52 143 3.40.50.1100
af_Q2FWJ9_55_154_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9629 52 147 3.40.50.1100
4d9gB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9511 72 143 3.40.50.1100
af_P36007_52_148_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9468 52 147 3.40.50.1100
af_P9WG95_65_164_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.945 52 147 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A2W4SR38-F1-model_v4 Serine/threonine dehydratase 0.9825 110 312 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A7V8FN82-F1-model_v4 Phenylserine dehydratase 0.9757 145 312 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A2W4QRT5-F1-model_v4 Serine/threonine dehydratase 0.9738 1 264 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-K1U779-F1-model_v4 Threonine ammonia-lyase 0.9738 168 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A535R5A4-F1-model_v4 Threonine/serine dehydratase 0.9735 3 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097

Feature Viewer

pLDDT pTM Quality
92.11 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map