F276897

General Info

Members Datasets Scaffolds Average Seq Length
181 152 179 140

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10119501|Ga0070710_101195013
Length 163
Sequence VPRRRGSSSGRSIGSWRTPDLAESAAGLERFVAAQSDGVYERALAEVRAGRKESHWMWFVFPQLAGLGRSGMARFYAIASLDEATAYVDHPVLGPRLRDAASAALATPHDLTAVDIFGEIDAVKLRSSVTLFGRAAPNEPVFAEVLERFFGGTPDRATLALLA

Samples

Sample ID Description Type Environment
1 2739367656 Pedobacter sp. CF523 Isolate Unclassified
2 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 1.1
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 6.63
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001374 3300005290 Bacteria 9140
2 Ga0065715_10111603 3300005293 Bacteria 2567
3 Ga0070658_10034039 3300005327 Bacteria 4099
4 Ga0070670_100002555 3300005331 Bacteria 15026
5 Ga0070677_10415011 3300005333 Bacteria 712
6 Ga0070666_10151855 3300005335 Bacteria 1616
7 Ga0070660_100222663 3300005339 Bacteria 1534
8 Ga0070660_101946648 3300005339 Bacteria 501
9 Ga0070661_100058645 3300005344 Bacteria 2821
10 Ga0070661_100464778 3300005344 Bacteria 1008
11 Ga0070668_100557543 3300005347 Unclassified 998
12 Ga0070669_100428932 3300005353 Unclassified 1086
13 Ga0070675_100001380 3300005354 Bacteria 17792
14 Ga0070671_100001131 3300005355 Bacteria 19813
15 Ga0070673_100010919 3300005364 Bacteria 6176
16 Ga0070659_100115650 3300005366 Bacteria 2168
17 Ga0070667_100023592 3300005367 Bacteria 5106
18 Ga0070714_100964828 3300005435 Bacteria 829
19 Ga0070710_10119501 3300005437 Bacteria 1593
20 Ga0070711_100992943 3300005439 Bacteria 720
21 Ga0070708_100120294 3300005445 Bacteria 2422
22 Ga0070708_100158170 3300005445 Bacteria 2110
23 Ga0070663_101578047 3300005455 Bacteria 585
24 Ga0070662_100005791 3300005457 Bacteria 7919
25 Ga0070706_100123057 3300005467 Bacteria 2419
26 Ga0070707_100039343 3300005468 Bacteria 4519
27 Ga0070707_100412320 3300005468 Archaea 1311
28 Ga0070698_100066099 3300005471 Bacteria 3640
29 Ga0070679_100005037 3300005530 Bacteria 12195
30 Ga0070684_100007437 3300005535 Bacteria 8514
31 Ga0068853_100462521 3300005539 Bacteria 1194
32 Ga0070672_100000323 3300005543 Bacteria 27239
33 Ga0070665_100128235 3300005548 Bacteria 2539
34 Ga0070665_100317494 3300005548 Bacteria 1562
35 Ga0068855_100138647 3300005563 Bacteria 2774
36 Ga0070664_100001074 3300005564 Bacteria 21518
37 Ga0068857_100032969 3300005577 Bacteria 4580
38 Ga0070702_100113271 3300005615 Bacteria 1686
39 Ga0068852_101669228 3300005616 Bacteria 660
40 Ga0068851_10332588 3300005834 Bacteria 880
41 Ga0075428_100289291 3300006844 Bacteria 1763
42 Ga0075428_100418337 3300006844 Bacteria 1436
43 Ga0105240_10516741 3300009093 Bacteria 1326
44 Ga0111539_10052772 3300009094 Bacteria 4840
45 Ga0111539_12754867 3300009094 Unclassified 570
46 Ga0105243_11293006 3300009148 Bacteria 746
47 Ga0105241_10181771 3300009174 Bacteria 1745
48 Ga0105242_10012373 3300009176 Bacteria 6568
49 Ga0105248_10011196 3300009177 Bacteria 9892
50 Ga0105237_10147622 3300009545 Bacteria 2347
51 Ga0105238_11672548 3300009551 Bacteria 667
52 Ga0105246_10002526 3300011119 Bacteria 11060
53 Ga0157319_1000023 3300012497 Bacteria 74829
54 Ga0157373_11234290 3300013100 Unclassified 564
55 Ga0157370_10000379 3300013104 Bacteria 56039
56 Ga0157374_10810502 3300013296 Bacteria 952
57 Ga0157372_10079001 3300013307 Bacteria 3719
58 Ga0157372_10093909 3300013307 Bacteria 3414
59 Ga0157375_10613288 3300013308 Bacteria 1247
60 Ga0163163_10535185 3300014325 Unclassified 1234
61 Ga0182008_10018125 3300014497 Bacteria 3647
62 Ga0157376_12039709 3300014969 Bacteria 612
63 Ga0182006_1068156 3300015261 Bacteria 1326
64 Ga0163161_10457120 3300017792 Bacteria 1033
65 Ga0163161_11253500 3300017792 Bacteria 643
66 Ga0207426_1034747 3300025302 Bacteria 1615
67 Ga0207656_10281667 3300025321 Bacteria 820
68 Ga0207682_10048119 3300025893 Bacteria 1757
69 Ga0207692_10672364 3300025898 Bacteria 670
70 Ga0207688_10134692 3300025901 Unclassified 1450
71 Ga0207688_10214878 3300025901 Unclassified 1156
72 Ga0207705_10005137 3300025909 Bacteria 9809
73 Ga0207671_10077798 3300025914 Bacteria 2483
74 Ga0207649_10456833 3300025920 Bacteria 965
75 Ga0207652_10000871 3300025921 Bacteria 28598
76 Ga0207646_10109380 3300025922 Bacteria 2480
77 Ga0207681_10474134 3300025923 Unclassified 1021
78 Ga0207650_10002370 3300025925 Bacteria 13104
79 Ga0207659_10005500 3300025926 Bacteria 7685
80 Ga0207644_10001377 3300025931 Bacteria 15658
81 Ga0207690_10930428 3300025932 Unclassified 722
82 Ga0207706_10002494 3300025933 Bacteria 17927
83 Ga0207706_11162214 3300025933 Bacteria 643
84 Ga0207670_11753654 3300025936 Bacteria 528
85 Ga0207669_10551173 3300025937 Bacteria 930
86 Ga0207691_10001103 3300025940 Bacteria 26864
87 Ga0207691_10047033 3300025940 Bacteria 3962
88 Ga0207711_10010681 3300025941 Bacteria 7634
89 Ga0207661_10158543 3300025944 Bacteria 1962
90 Ga0207679_10004452 3300025945 Bacteria 8731
91 Ga0207667_10413155 3300025949 Bacteria 1373
92 Ga0207651_10096963 3300025960 Bacteria 2176
93 Ga0207712_12143127 3300025961 Bacteria 500
94 Ga0207668_10652914 3300025972 Bacteria 921
95 Ga0207658_10185207 3300025986 Bacteria 1726
96 Ga0207639_10677779 3300026041 Bacteria 955
97 Ga0207639_10865239 3300026041 Bacteria 844
98 Ga0207676_10353047 3300026095 Bacteria 1360
99 Ga0207674_10044349 3300026116 Bacteria 4580
100 Ga0207698_10168708 3300026142 Bacteria 1925
101 Ga0207428_10041796 3300027907 Bacteria 3710
102 Ga0207428_10152935 3300027907 Bacteria 1755
103 Ga0268266_10037780 3300028379 Bacteria 4111
104 Ga0268266_10101470 3300028379 Bacteria 2537
105 Ga0268266_10142436 3300028379 Bacteria 2152
106 Ga0265318_10014953 3300028577 Bacteria 3244
107 Ga0265328_10292607 3300031239 Bacteria 628
108 Ga0265339_10033986 3300031249 Bacteria 2868
109 Ga0265316_10876885 3300031344 Bacteria 627
110 Ga0265313_10026912 3300031595 Bacteria 3019
111 Ga0265314_10039514 3300031711 Bacteria 3397
112 Ga0265342_10440569 3300031712 Bacteria 669
113 Ga0307407_10046766 3300031903 Bacteria 2452
114 Ga0307409_100009935 3300031995 Bacteria 5878
115 Ga0307409_100286955 3300031995 Bacteria 1524
116 Ga0395899_0618072 3300037312 Bacteria 688
117 Ga0395899_0678816 3300037312 Bacteria 648
118 Ga0395900_0184286 3300037418 Bacteria 2119
119 Ga0395898_0081349 3300037466 Bacteria 3123
120 Ga0395898_0240705 3300037466 Bacteria 1726
121 Ga0436364_0846552 3300037853 Bacteria 865
122 Ga0395901_0632412 3300038443 Bacteria 1076
123 Ga0451787_524315 3300041441 Bacteria 526
124 Ga0451802_1914728 3300041460 Bacteria 2360
125 Ga0451577_0017541 3300042876 Bacteria 6613
126 Ga0466969_0001101 3300044656 Bacteria 14596
127 Ga0466965_0286263 3300044683 Bacteria 891
128 Ga0466966_0021670 3300044684 Bacteria 4217
129 Ga0466961_0035536 3300044693 Bacteria 3200
130 Ga0466961_0042692 3300044693 Bacteria 2906
131 Ga0466963_0043236 3300044694 Bacteria 2961
132 Ga0466964_0619291 3300044706 Bacteria 595
133 Ga0453684_0648017 3300044712 Bacteria 1153
134 Ga0466968_0016490 3300044735 Bacteria 2942
135 Ga0466968_0501690 3300044735 Bacteria 605
136 Ga0466970_0454856 3300044765 Bacteria 734
137 Ga0466957_0599204 3300044842 Bacteria 771
138 Ga0466958_0040793 3300045836 Bacteria 2790
139 Ga0466958_0181371 3300045836 Bacteria 1336
140 Ga0466967_0105405 3300045976 Bacteria 2583
141 Ga0495592_0049000 3300046454 Bacteria 3141
142 Ga0495606_0000126 3300046507 Bacteria 129862
143 Ga0495643_0001505 3300046522 Bacteria 21102
144 Ga0495648_0000072 3300046524 Bacteria 132630
145 Ga0495587_0743672 3300046536 Bacteria 537
146 Ga0495668_0023055 3300046616 Bacteria 3554
147 Ga0495659_0055676 3300046664 Bacteria 1450
148 Ga0495623_0032809 3300046679 Bacteria 3335
149 Ga0495669_0001693 3300046684 Bacteria 9026
150 Ga0495649_0000123 3300046694 Bacteria 67796
151 Ga0495649_0010011 3300046694 Bacteria 5605
152 Ga0495649_0104419 3300046694 Bacteria 1504
153 Ga0495674_0392513 3300047319 Bacteria 1121
154 Ga0495686_0060233 3300047472 Bacteria 2360
155 Ga0496101_0324008 3300048904 Unclassified 1209
156 Ga0496109_0020774 3300048912 Bacteria 5800
157 Ga0496109_0278184 3300048912 Bacteria 1577
158 Ga0496110_0000825 3300048913 Bacteria 21743
159 Ga0496111_0003586 3300048914 Bacteria 9618
160 Ga0496111_0168111 3300048914 Bacteria 1629
161 Ga0496114_0022248 3300048917 Bacteria 5165
162 Ga0496114_0028243 3300048917 Bacteria 4602
163 Ga0496114_0108878 3300048917 Bacteria 2372
164 Ga0496115_0881725 3300048918 Bacteria 691
165 Ga0496122_0003133 3300048925 Bacteria 22146
166 Ga0496123_0000536 3300048926 Bacteria 65382
167 Ga0496124_0038770 3300048927 Bacteria 4134
168 Ga0496124_0075496 3300048927 Bacteria 2784
169 Ga0495678_075283 3300049459 Bacteria 1226
170 Ga0501067_0028151 3300049583 Bacteria 3113
171 Ga0501217_018611 3300049661 Bacteria 1614
172 Ga0501035_0289966 3300049822 Bacteria 1381
173 nmdc:mga0k408_557959_c1 3300050493 Bacteria 677
174 nmdc:mga08y16_38890_c1 3300050511 Bacteria 4993
175 Ga0500578_0606341 3300053086 Bacteria 601
176 Ga0500616_0044106 3300053153 Bacteria 2380
177 Ga0587073_0135053 3300059492 Bacteria 682
178 Ga0587120_008655 3300059659 Bacteria 836
179 Ga0466962_0676666 3300061719 Bacteria 528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0055676 Ga0495659_0055676_739_1158 115
2 3300028379 Ga0268266_10101470 Ga0268266_101014703 116
3 3300028577 Ga0265318_10014953 Ga0265318_100149532 116
4 3300031239 Ga0265328_10292607 Ga0265328_102926071 116
5 3300031249 Ga0265339_10033986 Ga0265339_100339863 116
6 3300031344 Ga0265316_10876885 Ga0265316_108768852 116
7 3300031711 Ga0265314_10039514 Ga0265314_100395145 116
8 3300031712 Ga0265342_10440569 Ga0265342_104405691 116
9 3300037312 Ga0395899_0618072 Ga0395899_0618072_173_595 116
10 3300037418 Ga0395900_0184286 Ga0395900_0184286_972_1394 116
11 3300046694 Ga0495649_0010011 Ga0495649_0010011_4739_5161 118
12 3300025922 Ga0207646_10109380 Ga0207646_101093802 121
13 3300025961 Ga0207712_12143127 Ga0207712_121431271 127
14 3300044842 Ga0466957_0599204 Ga0466957_0599204_185_586 130
15 iso_pu_bacteria 2739367656 2739614367 131
16 3300009176 Ga0105242_10012373 Ga0105242_100123734 134
17 3300011119 Ga0105246_10002526 Ga0105246_100025262 134
18 3300014497 Ga0182008_10018125 Ga0182008_100181252 134
19 3300025936 Ga0207670_11753654 Ga0207670_117536541 135
20 3300037466 Ga0395898_0240705 Ga0395898_0240705_122_535 135
21 3300053153 Ga0500616_0044106 Ga0500616_0044106_1181_1600 135
22 iso_pu_bacteria 2896253425 2896256427 135
23 3300005344 Ga0070661_100464778 Ga0070661_1004647781 136
24 3300005435 Ga0070714_100964828 Ga0070714_1009648283 136
25 3300005530 Ga0070679_100005037 Ga0070679_1000050372 136
26 3300005535 Ga0070684_100007437 Ga0070684_1000074373 136
27 3300005563 Ga0068855_100138647 Ga0068855_1001386473 136
28 3300005577 Ga0068857_100032969 Ga0068857_1000329696 136
29 3300013307 Ga0157372_10079001 Ga0157372_100790015 136
30 3300013308 Ga0157375_10613288 Ga0157375_106132882 136
31 3300025901 Ga0207688_10214878 Ga0207688_102148782 136
32 3300025920 Ga0207649_10456833 Ga0207649_104568332 136
33 3300025944 Ga0207661_10158543 Ga0207661_101585433 136
34 3300025949 Ga0207667_10413155 Ga0207667_104131553 136
35 3300026041 Ga0207639_10677779 Ga0207639_106777792 136
36 3300026116 Ga0207674_10044349 Ga0207674_100443492 136
37 3300037853 Ga0436364_0846552 Ga0436364_0846552_64_480 136
38 3300042876 Ga0451577_0017541 Ga0451577_0017541_2913_3329 136
39 3300044712 Ga0453684_0648017 Ga0453684_0648017_440_856 136
40 3300048917 Ga0496114_0028243 Ga0496114_0028243_2000_2419 136
41 3300059492 Ga0587073_0135053 Ga0587073_0135053_213_632 136
42 3300059659 Ga0587120_008655 Ga0587120_008655_370_786 136
43 3300005339 Ga0070660_100222663 Ga0070660_1002226632 137
44 3300005445 Ga0070708_100158170 Ga0070708_1001581704 137
45 3300005548 Ga0070665_100128235 Ga0070665_1001282353 137
46 3300005834 Ga0068851_10332588 Ga0068851_103325882 137
47 3300009093 Ga0105240_10516741 Ga0105240_105167412 137
48 3300009174 Ga0105241_10181771 Ga0105241_101817712 137
49 3300009545 Ga0105237_10147622 Ga0105237_101476222 137
50 3300013100 Ga0157373_11234290 Ga0157373_112342901 137
51 3300013296 Ga0157374_10810502 Ga0157374_108105022 137
52 3300013307 Ga0157372_10093909 Ga0157372_100939095 137
53 3300025321 Ga0207656_10281667 Ga0207656_102816672 137
54 3300025914 Ga0207671_10077798 Ga0207671_100777981 137
55 3300025921 Ga0207652_10000871 Ga0207652_1000087120 137
56 3300028379 Ga0268266_10142436 Ga0268266_101424362 137
57 3300031595 Ga0265313_10026912 Ga0265313_100269126 137
58 3300031903 Ga0307407_10046766 Ga0307407_100467664 137
59 3300031995 Ga0307409_100286955 Ga0307409_1002869552 137
60 3300037466 Ga0395898_0081349 Ga0395898_0081349_1114_1533 137
61 3300038443 Ga0395901_0632412 Ga0395901_0632412_451_870 137
62 3300041441 Ga0451787_524315 Ga0451787_524315_21_446 137
63 3300044694 Ga0466963_0043236 Ga0466963_0043236_604_1035 137
64 3300045836 Ga0466958_0181371 Ga0466958_0181371_817_1248 137
65 3300047319 Ga0495674_0392513 Ga0495674_0392513_93_512 137
66 3300049583 Ga0501067_0028151 Ga0501067_0028151_1234_1656 137
67 3300005437 Ga0070710_10119501 Ga0070710_101195013 138
68 3300005445 Ga0070708_100120294 Ga0070708_1001202942 138
69 3300005467 Ga0070706_100123057 Ga0070706_1001230572 138
70 3300005468 Ga0070707_100039343 Ga0070707_1000393432 138
71 3300005471 Ga0070698_100066099 Ga0070698_1000660995 138
72 3300006844 Ga0075428_100418337 Ga0075428_1004183373 138
73 3300013104 Ga0157370_10000379 Ga0157370_1000037924 138
74 3300015261 Ga0182006_1068156 Ga0182006_10681562 138
75 3300044735 Ga0466968_0501690 Ga0466968_0501690_23_445 138
76 3300046507 Ga0495606_0000126 Ga0495606_0000126_69922_70344 138
77 3300046522 Ga0495643_0001505 Ga0495643_0001505_525_947 138
78 3300046694 Ga0495649_0000123 Ga0495649_0000123_5199_5621 138
79 3300046694 Ga0495649_0104419 Ga0495649_0104419_655_1077 138
80 3300049459 Ga0495678_075283 Ga0495678_075283_15_437 138
81 3300005439 Ga0070711_100992943 Ga0070711_1009929431 139
82 3300005455 Ga0070663_101578047 Ga0070663_1015780471 139
83 3300025302 Ga0207426_1034747 Ga0207426_10347472 139
84 3300037312 Ga0395899_0678816 Ga0395899_0678816_45_482 139
85 3300041460 Ga0451802_1914728 Ga0451802_1914728_903_1334 139
86 3300044656 Ga0466969_0001101 Ga0466969_0001101_3005_3436 139
87 3300044683 Ga0466965_0286263 Ga0466965_0286263_46_477 139
88 3300044684 Ga0466966_0021670 Ga0466966_0021670_664_1095 139
89 3300044765 Ga0466970_0454856 Ga0466970_0454856_136_567 139
90 3300046454 Ga0495592_0049000 Ga0495592_0049000_814_1251 139
91 3300046536 Ga0495587_0743672 Ga0495587_0743672_81_518 139
92 3300046679 Ga0495623_0032809 Ga0495623_0032809_376_813 139
93 3300047472 Ga0495686_0060233 Ga0495686_0060233_76_516 139
94 3300048914 Ga0496111_0168111 Ga0496111_0168111_939_1364 139
95 3300048925 Ga0496122_0003133 Ga0496122_0003133_3567_3992 139
96 3300048926 Ga0496123_0000536 Ga0496123_0000536_3147_3572 139
97 3300048927 Ga0496124_0075496 Ga0496124_0075496_2221_2646 139
98 3300049822 Ga0501035_0289966 Ga0501035_0289966_540_974 139
99 3300053086 Ga0500578_0606341 Ga0500578_0606341_74_511 139
100 3300005339 Ga0070660_101946648 Ga0070660_1019466481 140
101 3300005468 Ga0070707_100412320 Ga0070707_1004123201 140
102 3300005615 Ga0070702_100113271 Ga0070702_1001132711 140
103 3300005616 Ga0068852_101669228 Ga0068852_1016692281 140
104 3300006844 Ga0075428_100289291 Ga0075428_1002892913 140
105 3300009094 Ga0111539_10052772 Ga0111539_100527722 140
106 3300009094 Ga0111539_12754867 Ga0111539_127548671 140
107 3300009148 Ga0105243_11293006 Ga0105243_112930061 140
108 3300012497 Ga0157319_1000023 Ga0157319_100002381 140
109 3300014325 Ga0163163_10535185 Ga0163163_105351851 140
110 3300014969 Ga0157376_12039709 Ga0157376_120397091 140
111 3300017792 Ga0163161_10457120 Ga0163161_104571202 140
112 3300025898 Ga0207692_10672364 Ga0207692_106723641 140
113 3300025933 Ga0207706_11162214 Ga0207706_111622141 140
114 3300025937 Ga0207669_10551173 Ga0207669_105511731 140
115 3300025940 Ga0207691_10047033 Ga0207691_100470333 140
116 3300026142 Ga0207698_10168708 Ga0207698_101687083 140
117 3300027907 Ga0207428_10041796 Ga0207428_100417963 140
118 3300027907 Ga0207428_10152935 Ga0207428_101529352 140
119 3300044693 Ga0466961_0042692 Ga0466961_0042692_2423_2875 140
120 3300046524 Ga0495648_0000072 Ga0495648_0000072_64788_65222 140
121 3300048912 Ga0496109_0020774 Ga0496109_0020774_1999_2427 140
122 3300048917 Ga0496114_0022248 Ga0496114_0022248_135_563 140
123 3300048917 Ga0496114_0108878 Ga0496114_0108878_1235_1678 140
124 3300048918 Ga0496115_0881725 Ga0496115_0881725_87_515 140
125 3300048927 Ga0496124_0038770 Ga0496124_0038770_498_926 140
126 3300050493 nmdc:mga0k408_557959_c1 nmdc:mga0k408_557959_c1_46_474 140
127 3300050511 nmdc:mga08y16_38890_c1 nmdc:mga08y16_38890_c1_2318_2764 140
128 3300005290 Ga0065712_10001374 Ga0065712_1000137410 141
129 3300005293 Ga0065715_10111603 Ga0065715_101116032 141
130 3300005327 Ga0070658_10034039 Ga0070658_100340393 141
131 3300005331 Ga0070670_100002555 Ga0070670_10000255512 141
132 3300005333 Ga0070677_10415011 Ga0070677_104150112 141
133 3300005335 Ga0070666_10151855 Ga0070666_101518553 141
134 3300005344 Ga0070661_100058645 Ga0070661_1000586452 141
135 3300005347 Ga0070668_100557543 Ga0070668_1005575432 141
136 3300005353 Ga0070669_100428932 Ga0070669_1004289322 141
137 3300005354 Ga0070675_100001380 Ga0070675_1000013809 141
138 3300005355 Ga0070671_100001131 Ga0070671_10000113116 141
139 3300005364 Ga0070673_100010919 Ga0070673_1000109198 141
140 3300005366 Ga0070659_100115650 Ga0070659_1001156504 141
141 3300005367 Ga0070667_100023592 Ga0070667_1000235926 141
142 3300005457 Ga0070662_100005791 Ga0070662_1000057917 141
143 3300005539 Ga0068853_100462521 Ga0068853_1004625211 141
144 3300005543 Ga0070672_100000323 Ga0070672_10000032310 141
145 3300005548 Ga0070665_100317494 Ga0070665_1003174941 141
146 3300005564 Ga0070664_100001074 Ga0070664_10000107417 141
147 3300009177 Ga0105248_10011196 Ga0105248_100111968 141
148 3300009551 Ga0105238_11672548 Ga0105238_116725482 141
149 3300017792 Ga0163161_11253500 Ga0163161_112535001 141
150 3300025893 Ga0207682_10048119 Ga0207682_100481194 141
151 3300025901 Ga0207688_10134692 Ga0207688_101346922 141
152 3300025909 Ga0207705_10005137 Ga0207705_100051377 141
153 3300025923 Ga0207681_10474134 Ga0207681_104741342 141
154 3300025925 Ga0207650_10002370 Ga0207650_100023707 141
155 3300025926 Ga0207659_10005500 Ga0207659_100055003 141
156 3300025931 Ga0207644_10001377 Ga0207644_1000137712 141
157 3300025932 Ga0207690_10930428 Ga0207690_109304281 141
158 3300025933 Ga0207706_10002494 Ga0207706_1000249417 141
159 3300025940 Ga0207691_10001103 Ga0207691_1000110321 141
160 3300025941 Ga0207711_10010681 Ga0207711_100106818 141
161 3300025945 Ga0207679_10004452 Ga0207679_1000445212 141
162 3300025960 Ga0207651_10096963 Ga0207651_100969633 141
163 3300025972 Ga0207668_10652914 Ga0207668_106529142 141
164 3300025986 Ga0207658_10185207 Ga0207658_101852073 141
165 3300026041 Ga0207639_10865239 Ga0207639_108652392 141
166 3300026095 Ga0207676_10353047 Ga0207676_103530473 141
167 3300028379 Ga0268266_10037780 Ga0268266_100377807 141
168 3300031995 Ga0307409_100009935 Ga0307409_1000099352 141
169 3300044693 Ga0466961_0035536 Ga0466961_0035536_153_584 141
170 3300044706 Ga0466964_0619291 Ga0466964_0619291_113_544 141
171 3300044735 Ga0466968_0016490 Ga0466968_0016490_2353_2784 141
172 3300045836 Ga0466958_0040793 Ga0466958_0040793_2010_2441 141
173 3300045976 Ga0466967_0105405 Ga0466967_0105405_1772_2203 141
174 3300046616 Ga0495668_0023055 Ga0495668_0023055_1812_2243 141
175 3300046684 Ga0495669_0001693 Ga0495669_0001693_2801_3226 141
176 3300048904 Ga0496101_0324008 Ga0496101_0324008_326_751 141
177 3300048912 Ga0496109_0278184 Ga0496109_0278184_889_1314 141
178 3300048913 Ga0496110_0000825 Ga0496110_0000825_7783_8208 141
179 3300048914 Ga0496111_0003586 Ga0496111_0003586_245_670 141
180 3300049661 Ga0501217_018611 Ga0501217_018611_1150_1587 141
181 3300061719 Ga0466962_0676666 Ga0466962_0676666_17_475 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

25

162

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9728 3 139
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9456 3 139
5zig-assembly3.cif.gz_C the structure of cellobiose 2-epimerase from spirochaeta thermophila dsm 6192 0.5553 62 124
3wre-assembly1.cif.gz_A-2 the crystal structure of native hypba1 from bifidobacterium longum jcm 1217 0.5117 10 125
8bs0-assembly1.cif.gz_A room-temperature structure of pedobacter heparinus n-acetylglucosamine 2-epimerase at 80 mpa helium gas pressure in a sapphire capillary 0.4828 46 124
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9728 3 139 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9456 3 139 1.25.40.380
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5863 2 123 1.25.10.10
af_Q23669_523_708_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5478 59 125 1.25.10.10
af_Q4D4F2_2_196_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5434 59 126 1.25.10.10
ID Description Score Start End GO Terms
AF-C5B6R2-F1-model_v4 Calpastatin 1.002 7 83
AF-A0A522B0J8-F1-model_v4 DUF1810 family protein 1 7 69
AF-A0A369PWU4-F1-model_v4 DUF1810 family protein 0.9997 7 71
AF-A0A4R1VH71-F1-model_v4 Uncharacterized protein (DUF1810 family) 0.9995 7 110
AF-A0A849WR08-F1-model_v4 DUF1810 family protein 0.9967 7 82

Feature Viewer

pLDDT pTM Quality
96.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map