F276811

General Info

Members Datasets Scaffolds Average Seq Length
181 122 172 149

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10081613|Ga0070691_100816131
Length 152
Sequence MIVYRIALAKYAGGLVASGNPGRWNSKDVKIIYTAGSRSLACLENVVHRSSLGLRDNFRIMLIDIPNDLPLQEIPIGSLDPGWRRYDRYPYTQETGDRWVKGESSAVLKVPSAIIPEEFNYLLNPLQGDFARITYMGNQPFDFDERIKGPLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
7 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
104 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
105 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
113 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
114 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
115 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0.55
Isolates 5.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.81
Nodule 0
Rhizoplane 0.55
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_493616 2162886007 Bacteria 15810
2 JGI24740J21852_10007225 3300001979 Bacteria 4527
3 JGI25162J39368_1001793 3300002737 Bacteria 10128
4 JGI25154J39366_1000047 3300002738 Bacteria 126449
5 JGI25157J39369_1011444 3300002741 Bacteria 1148
6 JGI25164J39214_1001237 3300002772 Bacteria 6806
7 JGI25153J46596_10005719 3300003215 Bacteria 6484
8 rootH2_10057796 3300003320 Bacteria 14763
9 rootL2_10136765 3300003322 Bacteria 1356
10 rootL2_10156028 3300003322 Bacteria 2880
11 rootH1_10010138 3300003323 Bacteria 25280
12 rootH1_10010139 3300003323 Bacteria 13169
13 rootH1_10046090 3300003316 Bacteria 1747
14 rootH1_10046090 3300003323 Bacteria 2200
15 JGI25160J50197_1016964 3300003354 Bacteria 2326
16 Ga0058863_10003096 3300004799 Bacteria 2844
17 Ga0065165_1093251 3300005262 Bacteria 764
18 Ga0065714_10003657 3300005288 Bacteria 30790
19 Ga0065714_10064664 3300005288 Bacteria 25064
20 Ga0065714_10064897 3300005288 Bacteria 15960
21 Ga0065714_10072134 3300005288 Bacteria 3425
22 Ga0065714_10080252 3300005288 Unclassified 2454
23 Ga0065714_10152372 3300005288 Bacteria 1098
24 Ga0065714_10391075 3300005288 Bacteria 598
25 Ga0065704_10000193 3300005289 Bacteria 203271
26 Ga0065704_10140581 3300005289 Bacteria 1521
27 Ga0065704_10218114 3300005289 Bacteria 1084
28 Ga0070658_10214307 3300005327 Bacteria 1627
29 Ga0070683_100149364 3300005329 Bacteria 2215
30 Ga0070670_101901818 3300005331 Bacteria 548
31 Ga0070680_100007970 3300005336 Bacteria 8085
32 Ga0070660_100001807 3300005339 Bacteria 14682
33 Ga0070691_10081613 3300005341 Unclassified 1584
34 Ga0070681_10072605 3300005458 Bacteria 3404
35 Ga0070681_10078888 3300005458 Bacteria 3249
36 Ga0070679_100030827 3300005530 Bacteria 5298
37 Ga0070679_100322308 3300005530 Bacteria 1494
38 Ga0068853_100198456 3300005539 Bacteria 1825
39 Ga0070672_101565233 3300005543 Bacteria 591
40 Ga0068855_100453878 3300005563 Bacteria 1398
41 Ga0068855_102086349 3300005563 Bacteria 571
42 Ga0068857_100064955 3300005577 Bacteria 3244
43 Ga0068856_100345995 3300005614 Bacteria 1505
44 Ga0068856_101121899 3300005614 Bacteria 804
45 Ga0068863_101206899 3300005841 Unclassified 762
46 Ga0068871_100416295 3300006358 Bacteria 1199
47 Ga0105240_10039125 3300009093 Bacteria 6076
48 Ga0105240_10232892 3300009093 Unclassified 2139
49 Ga0105240_10746048 3300009093 Unclassified 1065
50 Ga0111539_10646197 3300009094 Bacteria 1232
51 Ga0105241_10370044 3300009174 Unclassified 1249
52 Ga0105237_10008366 3300009545 Bacteria 11216
53 Ga0105237_10610085 3300009545 Unclassified 1098
54 Ga0105238_11367725 3300009551 Unclassified 735
55 Ga0105239_10020154 3300010375 Bacteria 7357
56 Ga0105239_10242424 3300010375 Bacteria 2023
57 Ga0157373_10000136 3300013100 Bacteria 57912
58 Ga0157373_10013184 3300013100 Bacteria 6067
59 Ga0157373_10016193 3300013100 Bacteria 5441
60 Ga0157373_10093092 3300013100 Bacteria 2123
61 Ga0157373_10671408 3300013100 Bacteria 758
62 Ga0157371_10003233 3300013102 Bacteria 14952
63 Ga0157371_10007846 3300013102 Bacteria 8568
64 Ga0157371_10041621 3300013102 Bacteria 3278
65 Ga0157371_10074361 3300013102 Bacteria 2407
66 Ga0157371_10077564 3300013102 Bacteria 2352
67 Ga0157370_10055024 3300013104 Bacteria 3792
68 Ga0157370_10136160 3300013104 Bacteria 2289
69 Ga0157370_10170487 3300013104 Bacteria 2023
70 Ga0157370_10241771 3300013104 Bacteria 1670
71 Ga0157370_10537311 3300013104 Bacteria 1072
72 Ga0157370_10783742 3300013104 Unclassified 868
73 Ga0157370_10986416 3300013104 Unclassified 763
74 Ga0157369_10040311 3300013105 Bacteria 5098
75 Ga0157369_10130419 3300013105 Bacteria 2664
76 Ga0163162_10723164 3300013306 Bacteria 1116
77 Ga0157372_10000312 3300013307 Bacteria 53617
78 Ga0157372_10281659 3300013307 Bacteria 1933
79 Ga0157372_10437106 3300013307 Unclassified 1525
80 Ga0157372_10749685 3300013307 Bacteria 1135
81 Ga0182008_10000018 3300014497 Bacteria 230609
82 Ga0182006_1006226 3300015261 Bacteria 5568
83 Ga0207427_100043 3300025231 Bacteria 249595
84 Ga0209437_100170 3300025233 Bacteria 142489
85 Ga0209646_1000003 3300025246 Bacteria 1160860
86 Ga0209026_1000303 3300025250 Bacteria 53764
87 Ga0209233_1000266 3300025261 Bacteria 76176
88 Ga0209455_1011840 3300025272 Bacteria 2125
89 Ga0209758_1002589 3300025297 Bacteria 18144
90 Ga0207426_1000738 3300025302 Bacteria 37211
91 Ga0207707_10391674 3300025912 Bacteria 1193
92 Ga0207695_10033969 3300025913 Bacteria 5552
93 Ga0207695_10149010 3300025913 Bacteria 2280
94 Ga0207671_10017936 3300025914 Bacteria 5444
95 Ga0207671_10445559 3300025914 Unclassified 1031
96 Ga0207660_10011090 3300025917 Bacteria 5858
97 Ga0207660_10109607 3300025917 Bacteria 2075
98 Ga0207657_10010608 3300025919 Bacteria 9183
99 Ga0207657_10233538 3300025919 Bacteria 1470
100 Ga0207652_10029278 3300025921 Bacteria 4603
101 Ga0207652_10094512 3300025921 Bacteria 2632
102 Ga0207659_10413453 3300025926 Bacteria 1130
103 Ga0207661_10194544 3300025944 Bacteria 1780
104 Ga0207667_11318915 3300025949 Bacteria 698
105 Ga0207702_10657959 3300026078 Bacteria 1031
106 Ga0207641_11375824 3300026088 Unclassified 707
107 Ga0307515_10000318 3300028794 Bacteria 118891
108 Ga0307511_10002561 3300030521 Bacteria 18975
109 Ga0307516_10083341 3300031730 Bacteria 3039
110 Ga0307412_10000077 3300031911 Bacteria 96375
111 Ga0307414_10000722 3300032004 Bacteria 16914
112 Ga0307414_10001142 3300032004 Bacteria 13596
113 Ga0307414_10217286 3300032004 Bacteria 1567
114 Ga0307414_10873723 3300032004 Bacteria 823
115 Ga0307507_10000313 3300033179 Bacteria 97672
116 Ga0395899_0106883 3300037312 Bacteria 2014
117 Ga0395899_0128451 3300037312 Bacteria 1811
118 Ga0395899_0170311 3300037312 Bacteria 1534
119 Ga0395900_0072935 3300037418 Bacteria 3529
120 Ga0395900_0139861 3300037418 Unclassified 2479
121 Ga0395900_0262074 3300037418 Bacteria 1726
122 Ga0395900_0936130 3300037418 Bacteria 788
123 Ga0395898_0194370 3300037466 Bacteria 1938
124 Ga0395898_0817944 3300037466 Bacteria 871
125 Ga0395905_0021044 3300037471 Bacteria 6175
126 Ga0395905_0098388 3300037471 Bacteria 2747
127 Ga0395901_0399323 3300038443 Bacteria 1412
128 Ga0395901_0428454 3300038443 Bacteria 1355
129 Ga0395901_0569518 3300038443 Bacteria 1146
130 Ga0451577_0200091 3300042876 Bacteria 1803
131 Ga0451577_0383275 3300042876 Bacteria 1276
132 Ga0453684_0142844 3300044712 Bacteria 2855
133 Ga0466957_0002326 3300044842 Bacteria 10195
134 Ga0451576_0000020 3300045051 Bacteria 529568
135 Ga0495638_0076216 3300046460 Bacteria 2043
136 Ga0495651_0102134 3300046462 Bacteria 2133
137 Ga0495651_0104259 3300046462 Bacteria 2106
138 Ga0495585_0154207 3300046492 Bacteria 1196
139 Ga0495606_0006803 3300046507 Bacteria 10441
140 Ga0495642_0227732 3300046528 Unclassified 814
141 Ga0495652_0234214 3300046529 Bacteria 1371
142 Ga0495652_0426602 3300046529 Bacteria 933
143 Ga0495625_0523984 3300046660 Bacteria 721
144 Ga0495625_0696472 3300046660 Bacteria 600
145 Ga0495660_0003458 3300046810 Bacteria 9754
146 Ga0495683_0465220 3300047323 Unclassified 517
147 Ga0496115_0571664 3300048918 Bacteria 901
148 Ga0501034_0079118 3300049571 Bacteria 3291
149 Ga0501036_1301705 3300049572 Bacteria 591
150 Ga0501038_0189988 3300049574 Bacteria 1653
151 Ga0501039_0511341 3300049575 Bacteria 943
152 Ga0501070_0203367 3300049586 Unclassified 1626
153 Ga0501243_011077 3300049675 Unclassified 1412
154 Ga0501269_014591 3300049766 Bacteria 964
155 Ga0501274_012807 3300049771 Unclassified 799
156 Ga0501035_0030386 3300049822 Bacteria 4925
157 Ga0501035_0247710 3300049822 Unclassified 1514
158 Ga0501044_0670899 3300049823 Bacteria 924
159 Ga0500644_0029796 3300053088 Bacteria 1720
160 Ga0500647_0380510 3300053091 Bacteria 578
161 Ga0500651_0000218 3300053093 Bacteria 35905
162 Ga0500566_0230140 3300053094 Bacteria 915
163 Ga0500594_0246426 3300053118 Unclassified 594
164 Ga0500608_144611 3300053122 Bacteria 1049
165 Ga0500618_000033 3300053125 Bacteria 121886
166 Ga0500642_0120939 3300053130 Bacteria 1225
167 Ga0500652_040903 3300053131 Bacteria 1864
168 Ga0500655_059865 3300053133 Unclassified 766
169 Ga0500559_0007880 3300053136 Bacteria 4701
170 Ga0500568_0066540 3300053139 Bacteria 1386
171 Ga0500588_0033514 3300053146 Bacteria 1499
172 Ga0500622_0002868 3300053156 Bacteria 12049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10152372 Ga0065714_101523722 134
2 3300005262 Ga0065165_1093251 Ga0065165_10932511 141
3 iso_pu_bacteria 2738541284 2738760996 145
4 iso_pu_bacteria 2738543023 2739301192 145
5 iso_pu_bacteria 2739367866 2740032898 145
6 iso_pu_bacteria 2775506987 2776613183 145
7 iso_pu_bacteria 2898713307 2898713581 145
8 iso_pu_bacteria 2911138879 2911142082 145
9 iso_pu_bacteria 2919186247 2919187228 145
10 iso_pu_bacteria 2929921140 2929927252 145
11 iso_pu_bacteria 2939664404 2939665503 145
12 iso_pu_bacteria 8003151029 8003151146 145
13 3300005331 Ga0070670_101901818 Ga0070670_1019018181 147
14 3300005543 Ga0070672_101565233 Ga0070672_1015652331 147
15 3300025926 Ga0207659_10413453 Ga0207659_104134532 147
16 3300032004 Ga0307414_10217286 Ga0307414_102172863 147
17 3300042876 Ga0451577_0383275 Ga0451577_0383275_52_504 147
18 3300044712 Ga0453684_0142844 Ga0453684_0142844_708_1160 147
19 3300053136 Ga0500559_0007880 Ga0500559_0007880_670_1116 148
20 2162886007 SwRhRL2b_contig_493616 SwRhRL2b_0792.00006050 149
21 3300001979 JGI24740J21852_10007225 JGI24740J21852_100072252 149
22 3300002737 JGI25162J39368_1001793 JGI25162J39368_100179313 149
23 3300002738 JGI25154J39366_1000047 JGI25154J39366_1000047110 149
24 3300002741 JGI25157J39369_1011444 JGI25157J39369_10114442 149
25 3300002772 JGI25164J39214_1001237 JGI25164J39214_10012372 149
26 3300003215 JGI25153J46596_10005719 JGI25153J46596_100057193 149
27 3300003320 rootH2_10057796 rootH2_1005779616 149
28 3300003322 rootL2_10136765 rootL2_101367652 149
29 3300003322 rootL2_10156028 rootL2_101560284 149
30 3300003323 rootH1_10010138 rootH1_1001013810 149
31 3300003323 rootH1_10010139 rootH1_100101393 149
32 3300003323 rootH1_10046090 rootH1_100460905 149
33 3300003354 JGI25160J50197_1016964 JGI25160J50197_10169642 149
34 3300004799 Ga0058863_10003096 Ga0058863_100030962 149
35 3300005288 Ga0065714_10003657 Ga0065714_1000365711 149
36 3300005288 Ga0065714_10064664 Ga0065714_1006466415 149
37 3300005288 Ga0065714_10064897 Ga0065714_100648973 149
38 3300005288 Ga0065714_10072134 Ga0065714_100721343 149
39 3300005288 Ga0065714_10080252 Ga0065714_100802523 149
40 3300005288 Ga0065714_10391075 Ga0065714_103910751 149
41 3300005289 Ga0065704_10000193 Ga0065704_1000019363 149
42 3300005289 Ga0065704_10140581 Ga0065704_101405811 149
43 3300005289 Ga0065704_10218114 Ga0065704_102181141 149
44 3300005327 Ga0070658_10214307 Ga0070658_102143072 149
45 3300005329 Ga0070683_100149364 Ga0070683_1001493643 149
46 3300005336 Ga0070680_100007970 Ga0070680_1000079705 149
47 3300005339 Ga0070660_100001807 Ga0070660_1000018078 149
48 3300005341 Ga0070691_10081613 Ga0070691_100816131 149
49 3300005458 Ga0070681_10072605 Ga0070681_100726057 149
50 3300005458 Ga0070681_10078888 Ga0070681_100788884 149
51 3300005530 Ga0070679_100030827 Ga0070679_1000308275 149
52 3300005530 Ga0070679_100322308 Ga0070679_1003223083 149
53 3300005539 Ga0068853_100198456 Ga0068853_1001984563 149
54 3300005563 Ga0068855_100453878 Ga0068855_1004538783 149
55 3300005563 Ga0068855_102086349 Ga0068855_1020863491 149
56 3300005577 Ga0068857_100064955 Ga0068857_1000649554 149
57 3300005614 Ga0068856_100345995 Ga0068856_1003459952 149
58 3300005614 Ga0068856_101121899 Ga0068856_1011218992 149
59 3300005841 Ga0068863_101206899 Ga0068863_1012068991 149
60 3300006358 Ga0068871_100416295 Ga0068871_1004162952 149
61 3300009093 Ga0105240_10039125 Ga0105240_100391254 149
62 3300009093 Ga0105240_10232892 Ga0105240_102328921 149
63 3300009093 Ga0105240_10746048 Ga0105240_107460482 149
64 3300009094 Ga0111539_10646197 Ga0111539_106461972 149
65 3300009174 Ga0105241_10370044 Ga0105241_103700442 149
66 3300009545 Ga0105237_10008366 Ga0105237_100083669 149
67 3300009545 Ga0105237_10610085 Ga0105237_106100852 149
68 3300009551 Ga0105238_11367725 Ga0105238_113677251 149
69 3300010375 Ga0105239_10020154 Ga0105239_100201543 149
70 3300010375 Ga0105239_10242424 Ga0105239_102424244 149
71 3300013100 Ga0157373_10000136 Ga0157373_1000013614 149
72 3300013100 Ga0157373_10013184 Ga0157373_100131845 149
73 3300013100 Ga0157373_10016193 Ga0157373_100161937 149
74 3300013100 Ga0157373_10093092 Ga0157373_100930922 149
75 3300013100 Ga0157373_10671408 Ga0157373_106714082 149
76 3300013102 Ga0157371_10003233 Ga0157371_100032338 149
77 3300013102 Ga0157371_10007846 Ga0157371_100078467 149
78 3300013102 Ga0157371_10041621 Ga0157371_100416212 149
79 3300013102 Ga0157371_10074361 Ga0157371_100743612 149
80 3300013102 Ga0157371_10077564 Ga0157371_100775642 149
81 3300013104 Ga0157370_10055024 Ga0157370_100550241 149
82 3300013104 Ga0157370_10136160 Ga0157370_101361605 149
83 3300013104 Ga0157370_10170487 Ga0157370_101704872 149
84 3300013104 Ga0157370_10241771 Ga0157370_102417711 149
85 3300013104 Ga0157370_10537311 Ga0157370_105373112 149
86 3300013104 Ga0157370_10783742 Ga0157370_107837422 149
87 3300013104 Ga0157370_10986416 Ga0157370_109864162 149
88 3300013105 Ga0157369_10040311 Ga0157369_100403113 149
89 3300013105 Ga0157369_10130419 Ga0157369_101304193 149
90 3300013306 Ga0163162_10723164 Ga0163162_107231642 149
91 3300013307 Ga0157372_10000312 Ga0157372_1000031220 149
92 3300013307 Ga0157372_10281659 Ga0157372_102816593 149
93 3300013307 Ga0157372_10437106 Ga0157372_104371062 149
94 3300013307 Ga0157372_10749685 Ga0157372_107496852 149
95 3300014497 Ga0182008_10000018 Ga0182008_10000018139 149
96 3300015261 Ga0182006_1006226 Ga0182006_10062268 149
97 3300025231 Ga0207427_100043 Ga0207427_10004318 149
98 3300025233 Ga0209437_100170 Ga0209437_100170101 149
99 3300025246 Ga0209646_1000003 Ga0209646_1000003896 149
100 3300025250 Ga0209026_1000303 Ga0209026_100030337 149
101 3300025261 Ga0209233_1000266 Ga0209233_100026633 149
102 3300025272 Ga0209455_1011840 Ga0209455_10118402 149
103 3300025297 Ga0209758_1002589 Ga0209758_100258911 149
104 3300025302 Ga0207426_1000738 Ga0207426_10007382 149
105 3300025912 Ga0207707_10391674 Ga0207707_103916742 149
106 3300025913 Ga0207695_10033969 Ga0207695_100339695 149
107 3300025913 Ga0207695_10149010 Ga0207695_101490101 149
108 3300025914 Ga0207671_10017936 Ga0207671_100179365 149
109 3300025914 Ga0207671_10445559 Ga0207671_104455591 149
110 3300025917 Ga0207660_10011090 Ga0207660_100110905 149
111 3300025917 Ga0207660_10109607 Ga0207660_101096072 149
112 3300025919 Ga0207657_10010608 Ga0207657_1001060811 149
113 3300025919 Ga0207657_10233538 Ga0207657_102335382 149
114 3300025921 Ga0207652_10029278 Ga0207652_100292782 149
115 3300025921 Ga0207652_10094512 Ga0207652_100945124 149
116 3300025944 Ga0207661_10194544 Ga0207661_101945443 149
117 3300025949 Ga0207667_11318915 Ga0207667_113189152 149
118 3300026078 Ga0207702_10657959 Ga0207702_106579592 149
119 3300026088 Ga0207641_11375824 Ga0207641_113758241 149
120 3300028794 Ga0307515_10000318 Ga0307515_1000031849 149
121 3300030521 Ga0307511_10002561 Ga0307511_100025618 149
122 3300031730 Ga0307516_10083341 Ga0307516_100833415 149
123 3300031911 Ga0307412_10000077 Ga0307412_1000007727 149
124 3300032004 Ga0307414_10000722 Ga0307414_1000072214 149
125 3300032004 Ga0307414_10001142 Ga0307414_100011423 149
126 3300032004 Ga0307414_10873723 Ga0307414_108737232 149
127 3300033179 Ga0307507_10000313 Ga0307507_1000031327 149
128 3300037312 Ga0395899_0106883 Ga0395899_0106883_803_1252 149
129 3300037312 Ga0395899_0128451 Ga0395899_0128451_846_1301 149
130 3300037312 Ga0395899_0170311 Ga0395899_0170311_842_1294 149
131 3300037418 Ga0395900_0072935 Ga0395900_0072935_894_1346 149
132 3300037418 Ga0395900_0139861 Ga0395900_0139861_278_727 149
133 3300037418 Ga0395900_0262074 Ga0395900_0262074_692_1144 149
134 3300037418 Ga0395900_0936130 Ga0395900_0936130_94_549 149
135 3300037466 Ga0395898_0194370 Ga0395898_0194370_803_1252 149
136 3300037466 Ga0395898_0817944 Ga0395898_0817944_135_590 149
137 3300037471 Ga0395905_0021044 Ga0395905_0021044_5047_5496 149
138 3300037471 Ga0395905_0098388 Ga0395905_0098388_898_1350 149
139 3300038443 Ga0395901_0399323 Ga0395901_0399323_273_722 149
140 3300038443 Ga0395901_0428454 Ga0395901_0428454_763_1218 149
141 3300038443 Ga0395901_0569518 Ga0395901_0569518_168_620 149
142 3300042876 Ga0451577_0200091 Ga0451577_0200091_502_954 149
143 3300044842 Ga0466957_0002326 Ga0466957_0002326_6297_6755 149
144 3300045051 Ga0451576_0000020 Ga0451576_0000020_461852_462304 149
145 3300046460 Ga0495638_0076216 Ga0495638_0076216_1193_1645 149
146 3300046462 Ga0495651_0102134 Ga0495651_0102134_1381_1830 149
147 3300046462 Ga0495651_0104259 Ga0495651_0104259_931_1380 149
148 3300046492 Ga0495585_0154207 Ga0495585_0154207_272_721 149
149 3300046507 Ga0495606_0006803 Ga0495606_0006803_9575_10024 149
150 3300046528 Ga0495642_0227732 Ga0495642_0227732_129_578 149
151 3300046529 Ga0495652_0234214 Ga0495652_0234214_390_839 149
152 3300046529 Ga0495652_0426602 Ga0495652_0426602_414_863 149
153 3300046660 Ga0495625_0523984 Ga0495625_0523984_38_487 149
154 3300046660 Ga0495625_0696472 Ga0495625_0696472_89_538 149
155 3300046810 Ga0495660_0003458 Ga0495660_0003458_3970_4419 149
156 3300047323 Ga0495683_0465220 Ga0495683_0465220_26_487 149
157 3300048918 Ga0496115_0571664 Ga0496115_0571664_73_522 149
158 3300049571 Ga0501034_0079118 Ga0501034_0079118_2617_3072 149
159 3300049572 Ga0501036_1301705 Ga0501036_1301705_26_481 149
160 3300049574 Ga0501038_0189988 Ga0501038_0189988_225_680 149
161 3300049575 Ga0501039_0511341 Ga0501039_0511341_449_904 149
162 3300049586 Ga0501070_0203367 Ga0501070_0203367_948_1403 149
163 3300049675 Ga0501243_011077 Ga0501243_011077_305_754 149
164 3300049766 Ga0501269_014591 Ga0501269_014591_348_800 149
165 3300049771 Ga0501274_012807 Ga0501274_012807_144_593 149
166 3300049822 Ga0501035_0030386 Ga0501035_0030386_803_1258 149
167 3300049822 Ga0501035_0247710 Ga0501035_0247710_473_928 149
168 3300049823 Ga0501044_0670899 Ga0501044_0670899_370_825 149
169 3300053088 Ga0500644_0029796 Ga0500644_0029796_351_809 149
170 3300053091 Ga0500647_0380510 Ga0500647_0380510_20_469 149
171 3300053093 Ga0500651_0000218 Ga0500651_0000218_34550_34999 149
172 3300053094 Ga0500566_0230140 Ga0500566_0230140_134_583 149
173 3300053118 Ga0500594_0246426 Ga0500594_0246426_60_518 149
174 3300053122 Ga0500608_144611 Ga0500608_144611_78_527 149
175 3300053125 Ga0500618_000033 Ga0500618_000033_31843_32292 149
176 3300053130 Ga0500642_0120939 Ga0500642_0120939_225_677 149
177 3300053131 Ga0500652_040903 Ga0500652_040903_370_822 149
178 3300053133 Ga0500655_059865 Ga0500655_059865_90_542 149
179 3300053139 Ga0500568_0066540 Ga0500568_0066540_357_806 149
180 3300053146 Ga0500588_0033514 Ga0500588_0033514_344_805 149
181 3300053156 Ga0500622_0002868 Ga0500622_0002868_3486_3944 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

2

144

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.9044 1 146
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.9033 2 146
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.8817 1 146
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.875 2 146
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.8438 1 146
ID Description Score Start End Superfamily
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.5706 1 141 3.20.170.10
af_K7UNG9_199_419_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.549 1 140 3.90.228.10
af_Q109A0_1_182_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5206 1 140 3.90.228.10
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.5179 1 141 3.20.170.10
af_K7UNG9_199_419_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.4999 1 140 3.90.228.10
ID Description Score Start End GO Terms
AF-A0A5B8VZM2-F1-model_v4 RES domain-containing protein 0.9915 1 149
AF-A0A6I7NSX4-F1-model_v4 RES domain-containing protein 0.9815 1 146
AF-A0A7K1YAQ4-F1-model_v4 RES domain-containing protein 0.9808 1 149
AF-A0A4Q5TZU5-F1-model_v4 RES domain-containing protein 0.979 1 148
AF-A0A1H8B4Z8-F1-model_v4 RES domain-containing protein 0.9748 1 147

Feature Viewer

pLDDT pTM Quality
94.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map