F276350

General Info

Members Datasets Scaffolds Average Seq Length
180 137 360 150

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0791681|Ga0501076_0791681_75_611
Length 178
Sequence MSMRRAISEIDSHQCLAEETTMSRLQLALNVDDLDASIAFYSKLFDTEPAKTKPGYANFAVTEPPLKLVLIENPGEGGSINHLGVEVADPEAVDATQARLATSGLASIDERDTTCCYARQDKFWVEGTPDGERWEVYAVLEHSDSFGVGDTEPVDGAGCCGQAASDQRELTPKATACC

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
37 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
123 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
124 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
136 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
137 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 1.11
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 7.78
Rhizosphere 79.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0791681 3300049592 Bacteria 782
2 rootH2_10070235 3300003320 Bacteria 2971
3 Ga0070658_10115205 3300005327 Bacteria 2229
4 Ga0070658_10874774 3300005327 Bacteria 781
5 Ga0070669_100028434 3300005353 Bacteria 4026
6 Ga0070659_100014320 3300005366 Bacteria 5925
7 Ga0070667_100006197 3300005367 Bacteria 9948
8 Ga0070714_100740289 3300005435 Bacteria 950
9 Ga0070701_11343884 3300005438 Bacteria 512
10 Ga0070700_100594837 3300005441 Bacteria 866
11 Ga0070700_101805210 3300005441 Bacteria 527
12 Ga0070707_100867494 3300005468 Bacteria 867
13 Ga0070679_100040967 3300005530 Bacteria 4610
14 Ga0070665_100007780 3300005548 Bacteria 10888
15 Ga0068855_101334523 3300005563 Bacteria 741
16 Ga0068855_101603329 3300005563 Bacteria 666
17 Ga0068852_100004567 3300005616 Bacteria 9800
18 Ga0068852_100723186 3300005616 Bacteria 1007
19 Ga0068859_100001411 3300005617 Bacteria 24387
20 Ga0068864_100295057 3300005618 Bacteria 1516
21 Ga0068861_101325401 3300005719 Bacteria 701
22 Ga0068863_100003552 3300005841 Bacteria 15379
23 Ga0068858_100125793 3300005842 Bacteria 2400
24 Ga0068860_100000025 3300005843 Bacteria 271553
25 Ga0068862_100000045 3300005844 Bacteria 155641
26 Ga0068862_100189147 3300005844 Bacteria 1851
27 Ga0075365_10304620 3300006038 Bacteria 1121
28 Ga0075364_10111988 3300006051 Bacteria 1822
29 Ga0070715_10400384 3300006163 Bacteria 763
30 Ga0075369_10006367 3300006186 Bacteria 4461
31 Ga0097620_100001411 3300006931 Bacteria 24387
32 Ga0105240_10760682 3300009093 Bacteria 1052
33 Ga0105245_10027914 3300009098 Bacteria 4974
34 Ga0105247_10000010 3300009101 Bacteria 302475
35 Ga0105243_12130500 3300009148 Bacteria 597
36 Ga0105241_10230408 3300009174 Bacteria 1561
37 Ga0105248_10000100 3300009177 Bacteria 95523
38 Ga0105237_10012093 3300009545 Bacteria 9114
39 Ga0105249_10000010 3300009553 Bacteria 306939
40 Ga0105249_10491677 3300009553 Bacteria 1271
41 Ga0105239_10088861 3300010375 Bacteria 3407
42 Ga0157317_1008542 3300012475 Bacteria 755
43 Ga0157313_1003649 3300012503 Bacteria 1009
44 Ga0157369_10164151 3300013105 Bacteria 2343
45 Ga0157378_11426854 3300013297 Bacteria 736
46 Ga0157372_11797301 3300013307 Bacteria 705
47 Ga0163163_10013644 3300014325 Bacteria 7441
48 Ga0163163_11139040 3300014325 Bacteria 843
49 Ga0157380_11428503 3300014326 Bacteria 743
50 Ga0157380_11469562 3300014326 Bacteria 734
51 Ga0157379_10053318 3300014968 Bacteria 3612
52 Ga0206356_10508837 3300020070 Bacteria 600
53 Ga0206353_11457232 3300020082 Bacteria 1359
54 Ga0213875_10297653 3300021388 Bacteria 763
55 Ga0207710_10000028 3300025900 Bacteria 304525
56 Ga0207647_10007362 3300025904 Bacteria 7957
57 Ga0207647_10019359 3300025904 Bacteria 4580
58 Ga0207647_10036823 3300025904 Bacteria 3106
59 Ga0207705_10165223 3300025909 Bacteria 1664
60 Ga0207705_10704254 3300025909 Bacteria 785
61 Ga0207671_10033639 3300025914 Bacteria 3812
62 Ga0207681_10016796 3300025923 Bacteria 4586
63 Ga0207687_10116606 3300025927 Bacteria 1991
64 Ga0207687_11695571 3300025927 Bacteria 542
65 Ga0207664_11284090 3300025929 Bacteria 651
66 Ga0207711_10001077 3300025941 Bacteria 26072
67 Ga0207661_11561468 3300025944 Bacteria 604
68 Ga0207667_10011333 3300025949 Bacteria 10367
69 Ga0207712_10000016 3300025961 Bacteria 343014
70 Ga0207658_10002012 3300025986 Bacteria 15163
71 Ga0207702_10122732 3300026078 Bacteria 2327
72 Ga0207641_10003491 3300026088 Bacteria 13924
73 Ga0207674_10109705 3300026116 Bacteria 2735
74 Ga0207698_10100202 3300026142 Bacteria 2399
75 Ga0268266_10016620 3300028379 Bacteria 6287
76 Ga0268265_10000056 3300028380 Bacteria 155720
77 Ga0268265_10120189 3300028380 Bacteria 2163
78 Ga0268264_10000053 3300028381 Bacteria 320368
79 Ga0265327_10000177 3300031251 Bacteria 136559
80 Ga0307405_10447949 3300031731 Bacteria 1023
81 Ga0307413_10017804 3300031824 Bacteria 3710
82 Ga0307413_10278540 3300031824 Bacteria 1257
83 Ga0307413_10306351 3300031824 Bacteria 1207
84 Ga0307410_10235094 3300031852 Bacteria 1417
85 Ga0307410_11002388 3300031852 Bacteria 720
86 Ga0307406_11087742 3300031901 Bacteria 690
87 Ga0307407_10073890 3300031903 Bacteria 2039
88 Ga0307407_10105106 3300031903 Bacteria 1761
89 Ga0307407_10486031 3300031903 Bacteria 903
90 Ga0307407_11229540 3300031903 Bacteria 586
91 Ga0307412_10618475 3300031911 Bacteria 920
92 Ga0307412_11651052 3300031911 Bacteria 586
93 Ga0307409_100182083 3300031995 Bacteria 1861
94 Ga0307409_100331362 3300031995 Bacteria 1428
95 Ga0307416_100366002 3300032002 Bacteria 1466
96 Ga0307416_100412331 3300032002 Bacteria 1392
97 Ga0307416_100770117 3300032002 Bacteria 1056
98 Ga0307411_11406501 3300032005 Bacteria 639
99 Ga0307415_100143643 3300032126 Bacteria 1826
100 Ga0307415_100301712 3300032126 Bacteria 1327
101 Ga0307415_100553774 3300032126 Bacteria 1015
102 Ga0395900_0026645 3300037418 Bacteria 5919
103 Ga0395898_0324380 3300037466 Bacteria 1469
104 Ga0436364_0072114 3300037853 Bacteria 3545
105 Ga0439465_0258255 3300041413 Bacteria 646
106 Ga0466963_0182131 3300044694 Bacteria 1467
107 Ga0466971_0215776 3300044719 Bacteria 908
108 Ga0466960_0080988 3300044901 Bacteria 1636
109 Ga0466959_0275581 3300045049 Bacteria 1156
110 Ga0466959_0707683 3300045049 Bacteria 675
111 Ga0466958_0167223 3300045836 Bacteria 1392
112 Ga0466967_0075031 3300045976 Bacteria 3039
113 Ga0466967_0128904 3300045976 Bacteria 2346
114 Ga0466967_0322970 3300045976 Bacteria 1489
115 Ga0466967_0447398 3300045976 Bacteria 1262
116 Ga0466967_0825842 3300045976 Bacteria 921
117 Ga0495641_0079449 3300046461 Bacteria 1470
118 Ga0495582_0411634 3300046473 Bacteria 780
119 Ga0495664_0074537 3300046477 Bacteria 2030
120 Ga0495594_0123011 3300046499 Bacteria 1467
121 Ga0495635_0085291 3300046663 Bacteria 2161
122 Ga0495635_0092108 3300046663 Bacteria 2073
123 Ga0495600_0341440 3300046809 Bacteria 939
124 Ga0496100_0050508 3300048903 Bacteria 2695
125 Ga0496101_0011361 3300048904 Bacteria 5906
126 Ga0496102_0004901 3300048905 Bacteria 11334
127 Ga0496103_0001258 3300048906 Bacteria 17302
128 Ga0496103_0027941 3300048906 Bacteria 3422
129 Ga0496106_0156795 3300048909 Bacteria 1798
130 Ga0496106_0702915 3300048909 Bacteria 806
131 Ga0496107_0028299 3300048910 Bacteria 3982
132 Ga0496107_0049719 3300048910 Bacteria 3022
133 Ga0496108_0684673 3300048911 Bacteria 890
134 Ga0496109_0183681 3300048912 Bacteria 1965
135 Ga0496109_0992837 3300048912 Bacteria 777
136 Ga0496110_1210826 3300048913 Bacteria 664
137 Ga0496111_1140520 3300048914 Bacteria 554
138 Ga0496116_0049892 3300048919 Bacteria 2793
139 Ga0496117_0005615 3300048920 Bacteria 13099
140 Ga0496118_0002000 3300048921 Bacteria 28889
141 Ga0496119_0000470 3300048922 Bacteria 54985
142 Ga0496119_0004540 3300048922 Bacteria 13767
143 Ga0496121_0018693 3300048924 Bacteria 6974
144 Ga0496124_0014280 3300048927 Bacteria 7687
145 Ga0496125_0109495 3300048928 Bacteria 2005
146 Ga0496126_0067156 3300048929 Bacteria 3204
147 Ga0501298_048500 3300049521 Bacteria 876
148 Ga0501032_0038622 3300049569 Bacteria 3250
149 Ga0501033_0046224 3300049570 Bacteria 3237
150 Ga0501033_0330230 3300049570 Bacteria 1070
151 Ga0501034_0004215 3300049571 Bacteria 16055
152 Ga0501034_0629100 3300049571 Bacteria 977
153 Ga0501037_0162380 3300049573 Bacteria 1592
154 Ga0501043_0115111 3300049579 Bacteria 2110
155 Ga0501046_0022292 3300049580 Bacteria 5217
156 Ga0501046_0043675 3300049580 Bacteria 3568
157 Ga0501047_0036134 3300049581 Bacteria 4773
158 Ga0501048_0030151 3300049582 Bacteria 3927
159 Ga0501069_0273311 3300049585 Bacteria 988
160 Ga0501070_0002516 3300049586 Bacteria 16067
161 Ga0501070_0050642 3300049586 Bacteria 3447
162 Ga0501070_0269126 3300049586 Bacteria 1392
163 Ga0501202_114972 3300049652 Bacteria 670
164 Ga0501206_020907 3300049653 Bacteria 933
165 Ga0501235_064192 3300049669 Bacteria 863
166 Ga0501225_0090543 3300049705 Bacteria 886
167 Ga0501080_0591076 3300049742 Bacteria 986
168 Ga0501035_0003563 3300049822 Bacteria 14872
169 Ga0501044_0009137 3300049823 Bacteria 10825
170 Ga0501212_023115 3300049851 Bacteria 973
171 nmdc:mga00v17_100010_c1 3300050491 Bacteria 1830
172 nmdc:mga0yw44_73705_c1 3300050492 Bacteria 2124
173 Ga0495601_0004326 3300053077 Bacteria 8204
174 Ga0500652_001286 3300053131 Bacteria 7952
175 Ga0466962_0084427 3300061719 Bacteria 1519
176 2753036327 2751185725 Bacteria 5740550
177 2753039217 2751185725 Bacteria 5740550
178 2753324198 2751185792 Bacteria 5739090
179 2753327829 2751185792 Bacteria 5739090
180 3006325625 3006321560 Bacteria 8247479
181 Ga0501076_0791681
182 rootH2_10070235
183 Ga0070658_10115205
184 Ga0070658_10874774
185 Ga0070669_100028434
186 Ga0070659_100014320
187 Ga0070667_100006197
188 Ga0070714_100740289
189 Ga0070701_11343884
190 Ga0070700_100594837
191 Ga0070700_101805210
192 Ga0070707_100867494
193 Ga0070679_100040967
194 Ga0070665_100007780
195 Ga0068855_101334523
196 Ga0068855_101603329
197 Ga0068852_100004567
198 Ga0068852_100723186
199 Ga0068859_100001411
200 Ga0068864_100295057
201 Ga0068861_101325401
202 Ga0068863_100003552
203 Ga0068858_100125793
204 Ga0068860_100000025
205 Ga0068862_100000045
206 Ga0068862_100189147
207 Ga0075365_10304620
208 Ga0075364_10111988
209 Ga0070715_10400384
210 Ga0075369_10006367
211 Ga0097620_100001411
212 Ga0105240_10760682
213 Ga0105245_10027914
214 Ga0105247_10000010
215 Ga0105243_12130500
216 Ga0105241_10230408
217 Ga0105248_10000100
218 Ga0105237_10012093
219 Ga0105249_10000010
220 Ga0105249_10491677
221 Ga0105239_10088861
222 Ga0157317_1008542
223 Ga0157313_1003649
224 Ga0157369_10164151
225 Ga0157378_11426854
226 Ga0157372_11797301
227 Ga0163163_10013644
228 Ga0163163_11139040
229 Ga0157380_11428503
230 Ga0157380_11469562
231 Ga0157379_10053318
232 Ga0206356_10508837
233 Ga0206353_11457232
234 Ga0213875_10297653
235 Ga0207710_10000028
236 Ga0207647_10007362
237 Ga0207647_10019359
238 Ga0207647_10036823
239 Ga0207705_10165223
240 Ga0207705_10704254
241 Ga0207671_10033639
242 Ga0207681_10016796
243 Ga0207687_10116606
244 Ga0207687_11695571
245 Ga0207664_11284090
246 Ga0207711_10001077
247 Ga0207661_11561468
248 Ga0207667_10011333
249 Ga0207712_10000016
250 Ga0207658_10002012
251 Ga0207702_10122732
252 Ga0207641_10003491
253 Ga0207674_10109705
254 Ga0207698_10100202
255 Ga0268266_10016620
256 Ga0268265_10000056
257 Ga0268265_10120189
258 Ga0268264_10000053
259 Ga0265327_10000177
260 Ga0307405_10447949
261 Ga0307413_10017804
262 Ga0307413_10278540
263 Ga0307413_10306351
264 Ga0307410_10235094
265 Ga0307410_11002388
266 Ga0307406_11087742
267 Ga0307407_10073890
268 Ga0307407_10105106
269 Ga0307407_10486031
270 Ga0307407_11229540
271 Ga0307412_10618475
272 Ga0307412_11651052
273 Ga0307409_100182083
274 Ga0307409_100331362
275 Ga0307416_100366002
276 Ga0307416_100412331
277 Ga0307416_100770117
278 Ga0307411_11406501
279 Ga0307415_100143643
280 Ga0307415_100301712
281 Ga0307415_100553774
282 Ga0395900_0026645
283 Ga0395898_0324380
284 Ga0436364_0072114
285 Ga0439465_0258255
286 Ga0466963_0182131
287 Ga0466971_0215776
288 Ga0466960_0080988
289 Ga0466959_0275581
290 Ga0466959_0707683
291 Ga0466958_0167223
292 Ga0466967_0075031
293 Ga0466967_0128904
294 Ga0466967_0322970
295 Ga0466967_0447398
296 Ga0466967_0825842
297 Ga0495641_0079449
298 Ga0495582_0411634
299 Ga0495664_0074537
300 Ga0495594_0123011
301 Ga0495635_0085291
302 Ga0495635_0092108
303 Ga0495600_0341440
304 Ga0496100_0050508
305 Ga0496101_0011361
306 Ga0496102_0004901
307 Ga0496103_0001258
308 Ga0496103_0027941
309 Ga0496106_0156795
310 Ga0496106_0702915
311 Ga0496107_0028299
312 Ga0496107_0049719
313 Ga0496108_0684673
314 Ga0496109_0183681
315 Ga0496109_0992837
316 Ga0496110_1210826
317 Ga0496111_1140520
318 Ga0496116_0049892
319 Ga0496117_0005615
320 Ga0496118_0002000
321 Ga0496119_0000470
322 Ga0496119_0004540
323 Ga0496121_0018693
324 Ga0496124_0014280
325 Ga0496125_0109495
326 Ga0496126_0067156
327 Ga0501298_048500
328 Ga0501032_0038622
329 Ga0501033_0046224
330 Ga0501033_0330230
331 Ga0501034_0004215
332 Ga0501034_0629100
333 Ga0501037_0162380
334 Ga0501043_0115111
335 Ga0501046_0022292
336 Ga0501046_0043675
337 Ga0501047_0036134
338 Ga0501048_0030151
339 Ga0501069_0273311
340 Ga0501070_0002516
341 Ga0501070_0050642
342 Ga0501070_0269126
343 Ga0501202_114972
344 Ga0501206_020907
345 Ga0501235_064192
346 Ga0501225_0090543
347 Ga0501080_0591076
348 Ga0501035_0003563
349 Ga0501044_0009137
350 Ga0501212_023115
351 nmdc:mga00v17_100010_c1
352 nmdc:mga0yw44_73705_c1
353 Ga0495601_0004326
354 Ga0500652_001286
355 Ga0466962_0084427
356 2753036327
357 2753039217
358 2753324198
359 2753327829
360 3006325625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9913 1 118
5d4f-assembly1.cif.gz_A crystal structure of c-as lyase with fe(iii) 0.9847 1 118
5hcw-assembly5.cif.gz_A crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.9793 1 118
5cb9-assembly1.cif.gz_A crystal structure of c-as lyase with mercaptoethonal 0.9781 1 118
5c68-assembly1.cif.gz_A crystal structure of c-as lyase at 1.46 angstroms resolution 0.9768 1 118
ID Description Score Start End Superfamily
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9649 1 120 3.10.180.10
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9567 1 120 3.10.180.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8721 5 52 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8657 5 51 3.30.720.120
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.776 5 56 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A369V3Y1-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9973 1 122 GO:0046686
GO:0051213
AF-A0A4V3DB96-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9972 1 122 GO:0016829
GO:0046686
GO:0051213
AF-A0A7J9XUD1-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9967 1 122 GO:0046686
GO:0051213
AF-A0A132NHH5-F1-model_v4 Glyoxalase 0.9967 1 121 GO:0046686
AF-A0A6M0BJY0-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9962 3 52 GO:0046686
GO:0051213

Map