F276255

General Info

Members Datasets Scaffolds Average Seq Length
180 117 163 400

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0095162|Ga0496114_0095162_486_1823
Length 435
Sequence VHQGRTLTDVMAERQQLRGGTTLAVAMGIMNITTYLYTILAARLLGPRDYGAFAALMGLLLVITVASLALQATAARRIVATPGNVHQIEHLILKVGVQASIGLGVLCLVLSPVINQVVRLDSLGTAALVAFAAAPLTMMGAQAGILQGERRWIALAMIYIGAGVPRLIIGTVLIVWWPNEFAALLGVAIAAYIPVAVGWLALRRPRDPGEVRALWSETLHNSHALLAFFALSNVDILVARNVLDEHQAGLYAGGLILVKAVLFLPQFVVVLAFPSMGVAESRLRTLLQSLVATGLIGAIVALGVTVLSGWAIIFVGGKQYSAISDWLWVFALLGGVLSMLQIVVYSVLARQARKSVYLLWIGLLAVVSLGSMADTFDELLRTVLGVDTTVLVVLVVISLLKLRHPTPAGTGSVGGGVPAAPSAHGDVEGNGQRSG

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
11 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
12 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
13 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
14 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
15 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
16 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
17 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0.56
Isolates 9.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.33
Nodule 0.56
Rhizoplane 4.44
Rhizosphere 62.22
Stem 0
Stem Tuber 0
Unclassified 9.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000744 3300000549 Bacteria 5156
2 JGI24744J21845_10004886 3300002077 Bacteria 2773
3 rootH1_10198855 3300003323 Bacteria 2915
4 Ga0070683_100030063 3300005329 Bacteria 4926
5 Ga0070683_100242609 3300005329 Bacteria 1714
6 Ga0070670_100139410 3300005331 Bacteria 2097
7 Ga0070680_100132998 3300005336 Bacteria 2082
8 Ga0070682_100013164 3300005337 Bacteria 4752
9 Ga0068868_100090459 3300005338 Bacteria 2465
10 Ga0070692_10007931 3300005345 Bacteria 4707
11 Ga0070674_100031653 3300005356 Bacteria 3507
12 Ga0070667_100173718 3300005367 Bacteria 1903
13 Ga0070714_100002926 3300005435 Bacteria 12640
14 Ga0070700_100006129 3300005441 Bacteria 6407
15 Ga0070698_100005020 3300005471 Bacteria 14497
16 Ga0070672_100094102 3300005543 Bacteria 2422
17 Ga0070702_100099416 3300005615 Bacteria 1781
18 Ga0068864_100101850 3300005618 Bacteria 2548
19 Ga0068866_10037617 3300005718 Bacteria 2378
20 Ga0068861_100019768 3300005719 Bacteria 4813
21 Ga0068861_100061485 3300005719 Bacteria 2883
22 Ga0068870_10003400 3300005840 Bacteria 6746
23 Ga0068860_100001520 3300005843 Bacteria 24976
24 Ga0081539_10073818 3300005985 Bacteria 1818
25 Ga0075365_10008577 3300006038 Bacteria 5817
26 Ga0075365_10014404 3300006038 Bacteria 4756
27 Ga0075365_10017335 3300006038 Bacteria 4404
28 Ga0075365_10023577 3300006038 Bacteria 3872
29 Ga0075365_10048035 3300006038 Bacteria 2808
30 Ga0075365_10109131 3300006038 Bacteria 1901
31 Ga0075365_10215115 3300006038 Bacteria 1348
32 Ga0075368_10001436 3300006042 Bacteria 7617
33 Ga0075368_10033359 3300006042 Bacteria 2003
34 Ga0075363_100000144 3300006048 Bacteria 17553
35 Ga0075363_100007349 3300006048 Bacteria 5056
36 Ga0075363_100016292 3300006048 Bacteria 3670
37 Ga0075363_100069914 3300006048 Bacteria 1905
38 Ga0075364_10014399 3300006051 Bacteria 4886
39 Ga0075364_10076190 3300006051 Bacteria 2213
40 Ga0075364_10125971 3300006051 Bacteria 1717
41 Ga0075362_10013571 3300006177 Bacteria 3264
42 Ga0075367_10012031 3300006178 Bacteria 4597
43 Ga0075367_10080996 3300006178 Bacteria 1964
44 Ga0075370_10007934 3300006353 Bacteria 5436
45 Ga0075370_10016983 3300006353 Bacteria 3925
46 Ga0075370_10072736 3300006353 Bacteria 1968
47 Ga0075370_10087010 3300006353 Bacteria 1800
48 Ga0068865_100015883 3300006881 Bacteria 4807
49 Ga0111539_10111851 3300009094 Bacteria 3204
50 Ga0105245_10070952 3300009098 Bacteria 3163
51 Ga0105243_10005504 3300009148 Bacteria 9874
52 Ga0105249_10148135 3300009553 Bacteria 2257
53 Ga0157372_10044133 3300013307 Bacteria 4939
54 Ga0157380_10037137 3300014326 Bacteria 3773
55 Ga0157377_10010067 3300014745 Bacteria 4667
56 Ga0206353_11546235 3300020082 Bacteria 2024
57 Ga0207688_10009829 3300025901 Bacteria 5205
58 Ga0207643_10006219 3300025908 Bacteria 6389
59 Ga0207690_10112977 3300025932 Bacteria 1959
60 Ga0207709_10014292 3300025935 Bacteria 4382
61 Ga0207709_10054088 3300025935 Bacteria 2473
62 Ga0207669_10022362 3300025937 Bacteria 3358
63 Ga0207691_10046173 3300025940 Bacteria 4005
64 Ga0207708_10000492 3300026075 Bacteria 30320
65 Ga0207708_10036322 3300026075 Bacteria 3751
66 Ga0207675_100046200 3300026118 Bacteria 4067
67 Ga0207675_100159106 3300026118 Bacteria 2154
68 Ga0209813_10017627 3300027866 Bacteria 1963
69 Ga0268264_10002957 3300028381 Bacteria 14761
70 Ga0307410_10088495 3300031852 Bacteria 2193
71 Ga0307410_10116447 3300031852 Bacteria 1942
72 Ga0307409_100002934 3300031995 Bacteria 9066
73 Ga0307409_100112017 3300031995 Bacteria 2290
74 Ga0307409_100134538 3300031995 Bacteria 2119
75 Ga0307415_100010101 3300032126 Bacteria 5328
76 Ga0307415_100041332 3300032126 Bacteria 3061
77 Ga0307415_100066768 3300032126 Bacteria 2511
78 Ga0395899_0027415 3300037312 Bacteria 4296
79 Ga0395900_0359616 3300037418 Bacteria 1427
80 Ga0395905_0013780 3300037471 Bacteria 7740
81 Ga0395901_0271508 3300038443 Bacteria 1764
82 Ga0466972_0003869 3300044658 Bacteria 7454
83 Ga0466972_0029215 3300044658 Bacteria 2714
84 Ga0466965_0001666 3300044683 Bacteria 9114
85 Ga0466965_0024870 3300044683 Bacteria 2897
86 Ga0466966_0037881 3300044684 Bacteria 3107
87 Ga0466966_0066038 3300044684 Bacteria 2274
88 Ga0466966_0113177 3300044684 Bacteria 1671
89 Ga0466966_0162667 3300044684 Bacteria 1359
90 Ga0466961_0006514 3300044693 Bacteria 7419
91 Ga0466961_0012871 3300044693 Bacteria 5352
92 Ga0466961_0049849 3300044693 Bacteria 2675
93 Ga0466963_0002050 3300044694 Bacteria 11107
94 Ga0466963_0098653 3300044694 Bacteria 1997
95 Ga0466963_0102270 3300044694 Bacteria 1962
96 Ga0466964_0010371 3300044706 Bacteria 3515
97 Ga0466971_0019403 3300044719 Bacteria 3019
98 Ga0466970_0004319 3300044765 Bacteria 6992
99 Ga0466970_0005591 3300044765 Bacteria 6246
100 Ga0466970_0027070 3300044765 Bacteria 3007
101 Ga0466957_0001696 3300044842 Bacteria 11580
102 Ga0466957_0005868 3300044842 Bacteria 6917
103 Ga0466957_0008325 3300044842 Bacteria 5897
104 Ga0466960_0017270 3300044901 Bacteria 3143
105 Ga0466960_0030269 3300044901 Bacteria 2490
106 Ga0466959_0020696 3300045049 Bacteria 4847
107 Ga0466967_0014863 3300045976 Bacteria 6084
108 Ga0466967_0035008 3300045976 Bacteria 4269
109 Ga0466967_0043089 3300045976 Bacteria 3906
110 Ga0496100_0042713 3300048903 Bacteria 2897
111 Ga0496105_0073011 3300048908 Bacteria 2835
112 Ga0496108_0158158 3300048911 Bacteria 1957
113 Ga0496109_0014026 3300048912 Bacteria 6966
114 Ga0496114_0015932 3300048917 Bacteria 6049
115 Ga0496114_0028157 3300048917 Bacteria 4608
116 Ga0496114_0046458 3300048917 Bacteria 3608
117 Ga0496114_0095162 3300048917 Bacteria 2534
118 Ga0501031_0030509 3300049568 Bacteria 3517
119 Ga0501031_0112816 3300049568 Bacteria 1775
120 Ga0501032_0025287 3300049569 Bacteria 4094
121 Ga0501033_0014462 3300049570 Bacteria 5992
122 Ga0501033_0047897 3300049570 Bacteria 3177
123 Ga0501034_0043045 3300049571 Bacteria 4571
124 Ga0501036_0005667 3300049572 Bacteria 10133
125 Ga0501037_0048535 3300049573 Bacteria 3110
126 Ga0501038_0001626 3300049574 Bacteria 20909
127 Ga0501039_0085755 3300049575 Bacteria 2453
128 Ga0501040_0015944 3300049576 Bacteria 4969
129 Ga0501042_0008017 3300049578 Bacteria 6950
130 Ga0501042_0108952 3300049578 Bacteria 1994
131 Ga0501043_0022403 3300049579 Bacteria 4955
132 Ga0501043_0069588 3300049579 Bacteria 2764
133 Ga0501043_0101163 3300049579 Bacteria 2265
134 Ga0501046_0001147 3300049580 Bacteria 25786
135 Ga0501046_0106874 3300049580 Bacteria 2141
136 Ga0501046_0149771 3300049580 Bacteria 1761
137 Ga0501047_0002734 3300049581 Bacteria 16802
138 Ga0501048_0037021 3300049582 Bacteria 3504
139 Ga0501067_0017548 3300049583 Bacteria 3961
140 Ga0501069_0057534 3300049585 Bacteria 2168
141 Ga0501080_0247036 3300049742 Bacteria 1627
142 Ga0501035_0041551 3300049822 Bacteria 4151
143 Ga0501044_0007051 3300049823 Bacteria 12365
144 nmdc:mga03683_6832_c1 3300050489 Bacteria 3928
145 nmdc:mga03n38_31591_c1 3300050490 Bacteria 2236
146 nmdc:mga03n38_51169_c1 3300050490 Bacteria 1844
147 nmdc:mga00v17_104513_c1 3300050491 Bacteria 1791
148 nmdc:mga00v17_108179_c1 3300050491 Bacteria 1762
149 nmdc:mga00v17_13324_c1 3300050491 Bacteria 4562
150 nmdc:mga00v17_31478_c1 3300050491 Bacteria 3129
151 nmdc:mga00v17_49287_c1 3300050491 Bacteria 2554
152 nmdc:mga00v17_57420_c1 3300050491 Bacteria 2381
153 nmdc:mga0yw44_37794_c1 3300050492 Bacteria 2853
154 nmdc:mga0yw44_71722_c1 3300050492 Bacteria 2151
155 nmdc:mga06z11_30124_c1 3300050494 Bacteria 2623
156 nmdc:mga06z11_6174_c1 3300050494 Bacteria 4856
157 nmdc:mga04h51_10224_c1 3300050495 Bacteria 2572
158 nmdc:mga04h51_44602_c1 3300050495 Bacteria 1463
159 nmdc:mga04h51_7020_c1 3300050495 Bacteria 2953
160 nmdc:mga07m45_72009_c1 3300050496 Bacteria 1967
161 Ga0500593_001097 3300053117 Bacteria 9764
162 Ga0466962_0018943 3300061719 Bacteria 3307
163 Ga0466962_0024944 3300061719 Bacteria 2871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0003869 Ga0466972_0003869_1935_3170 313
2 3300044765 Ga0466970_0027070 Ga0466970_0027070_882_2117 313
3 3300045976 Ga0466967_0043089 Ga0466967_0043089_53_1309 321
4 3300049570 Ga0501033_0047897 Ga0501033_0047897_1481_2752 323
5 3300049571 Ga0501034_0043045 Ga0501034_0043045_2216_3487 323
6 3300049572 Ga0501036_0005667 Ga0501036_0005667_3019_4290 323
7 3300049574 Ga0501038_0001626 Ga0501038_0001626_4488_5759 323
8 3300049581 Ga0501047_0002734 Ga0501047_0002734_12652_13923 323
9 3300049823 Ga0501044_0007051 Ga0501044_0007051_7167_8438 323
10 3300049578 Ga0501042_0008017 Ga0501042_0008017_31_1221 324
11 3300005719 Ga0068861_100019768 Ga0068861_1000197683 331
12 3300006038 Ga0075365_10048035 Ga0075365_100480353 333
13 3300031852 Ga0307410_10116447 Ga0307410_101164472 333
14 3300050492 nmdc:mga0yw44_37794_c1 nmdc:mga0yw44_37794_c1_227_1477 334
15 3300005367 Ga0070667_100173718 Ga0070667_1001737182 346
16 3300050491 nmdc:mga00v17_104513_c1 nmdc:mga00v17_104513_c1_136_1341 347
17 3300044765 Ga0466970_0004319 Ga0466970_0004319_4876_6120 348
18 3300048917 Ga0496114_0028157 Ga0496114_0028157_876_2129 348
19 3300006038 Ga0075365_10023577 Ga0075365_100235772 349
20 3300049568 Ga0501031_0112816 Ga0501031_0112816_117_1385 349
21 3300049569 Ga0501032_0025287 Ga0501032_0025287_826_2094 349
22 3300049573 Ga0501037_0048535 Ga0501037_0048535_433_1701 349
23 3300049575 Ga0501039_0085755 Ga0501039_0085755_411_1679 349
24 3300049578 Ga0501042_0108952 Ga0501042_0108952_436_1704 349
25 3300049579 Ga0501043_0069588 Ga0501043_0069588_395_1663 349
26 3300049580 Ga0501046_0106874 Ga0501046_0106874_775_2043 349
27 3300049582 Ga0501048_0037021 Ga0501048_0037021_2191_3459 349
28 3300049742 Ga0501080_0247036 Ga0501080_0247036_117_1385 349
29 3300049822 Ga0501035_0041551 Ga0501035_0041551_2194_3462 349
30 3300006038 Ga0075365_10008577 Ga0075365_100085772 350
31 3300006048 Ga0075363_100016292 Ga0075363_1000162922 350
32 3300006051 Ga0075364_10125971 Ga0075364_101259712 350
33 3300006177 Ga0075362_10013571 Ga0075362_100135712 350
34 3300006178 Ga0075367_10012031 Ga0075367_100120313 350
35 3300049585 Ga0501069_0057534 Ga0501069_0057534_420_1643 350
36 3300050489 nmdc:mga03683_6832_c1 nmdc:mga03683_6832_c1_505_1767 350
37 3300050490 nmdc:mga03n38_51169_c1 nmdc:mga03n38_51169_c1_166_1428 350
38 3300050491 nmdc:mga00v17_31478_c1 nmdc:mga00v17_31478_c1_398_1660 350
39 3300050494 nmdc:mga06z11_30124_c1 nmdc:mga06z11_30124_c1_914_2176 350
40 3300050495 nmdc:mga04h51_7020_c1 nmdc:mga04h51_7020_c1_118_1380 350
41 3300050496 nmdc:mga07m45_72009_c1 nmdc:mga07m45_72009_c1_225_1487 350
42 3300006038 Ga0075365_10017335 Ga0075365_100173352 351
43 3300006178 Ga0075367_10080996 Ga0075367_100809962 351
44 3300020082 Ga0206353_11546235 Ga0206353_115462352 352
45 3300026075 Ga0207708_10036322 Ga0207708_100363222 352
46 3300026118 Ga0207675_100046200 Ga0207675_1000462004 352
47 3300006042 Ga0075368_10001436 Ga0075368_100014362 353
48 3300006048 Ga0075363_100007349 Ga0075363_1000073495 353
49 3300027866 Ga0209813_10017627 Ga0209813_100176271 353
50 3300044684 Ga0466966_0162667 Ga0466966_0162667_69_1313 353
51 3300050490 nmdc:mga03n38_31591_c1 nmdc:mga03n38_31591_c1_142_1383 353
52 3300050494 nmdc:mga06z11_6174_c1 nmdc:mga06z11_6174_c1_2650_3891 353
53 3300050495 nmdc:mga04h51_10224_c1 nmdc:mga04h51_10224_c1_879_2120 353
54 3300006048 Ga0075363_100069914 Ga0075363_1000699142 354
55 3300006353 Ga0075370_10016983 Ga0075370_100169832 354
56 3300049576 Ga0501040_0015944 Ga0501040_0015944_3275_4558 354
57 3300050491 nmdc:mga00v17_108179_c1 nmdc:mga00v17_108179_c1_286_1533 354
58 3300050492 nmdc:mga0yw44_71722_c1 nmdc:mga0yw44_71722_c1_648_1916 354
59 3300050495 nmdc:mga04h51_44602_c1 nmdc:mga04h51_44602_c1_53_1300 354
60 3300006353 Ga0075370_10007934 Ga0075370_100079345 355
61 3300049570 Ga0501033_0014462 Ga0501033_0014462_3877_5136 355
62 3300049579 Ga0501043_0022403 Ga0501043_0022403_1274_2533 355
63 3300049580 Ga0501046_0001147 Ga0501046_0001147_17273_18532 355
64 3300003323 rootH1_10198855 rootH1_101988552 356
65 3300006042 Ga0075368_10033359 Ga0075368_100333592 356
66 3300031995 Ga0307409_100134538 Ga0307409_1001345382 356
67 3300049579 Ga0501043_0101163 Ga0501043_0101163_539_1798 357
68 3300006051 Ga0075364_10076190 Ga0075364_100761902 358
69 3300050491 nmdc:mga00v17_57420_c1 nmdc:mga00v17_57420_c1_231_1466 358
70 3300006048 Ga0075363_100000144 Ga0075363_10000014414 359
71 3300006051 Ga0075364_10014399 Ga0075364_100143991 359
72 3300006353 Ga0075370_10087010 Ga0075370_100870102 359
73 3300005843 Ga0068860_100001520 Ga0068860_10000152017 360
74 3300006038 Ga0075365_10109131 Ga0075365_101091311 360
75 3300028381 Ga0268264_10002957 Ga0268264_100029575 360
76 3300031995 Ga0307409_100112017 Ga0307409_1001120172 360
77 3300038443 Ga0395901_0271508 Ga0395901_0271508_311_1564 360
78 3300050491 nmdc:mga00v17_13324_c1 nmdc:mga00v17_13324_c1_3132_4409 360
79 3300044683 Ga0466965_0024870 Ga0466965_0024870_1355_2608 362
80 3300044901 Ga0466960_0030269 Ga0466960_0030269_64_1260 362
81 3300048917 Ga0496114_0046458 Ga0496114_0046458_101_1333 365
82 3300009098 Ga0105245_10070952 Ga0105245_100709521 366
83 3300025935 Ga0207709_10054088 Ga0207709_100540882 366
84 3300037471 Ga0395905_0013780 Ga0395905_0013780_772_2073 366
85 3300049583 Ga0501067_0017548 Ga0501067_0017548_2156_3325 366
86 3300005329 Ga0070683_100242609 Ga0070683_1002426091 367
87 3300005336 Ga0070680_100132998 Ga0070680_1001329982 367
88 3300037418 Ga0395900_0359616 Ga0395900_0359616_182_1366 367
89 3300048912 Ga0496109_0014026 Ga0496109_0014026_5590_6822 367
90 3300005435 Ga0070714_100002926 Ga0070714_1000029269 368
91 3300013307 Ga0157372_10044133 Ga0157372_100441333 368
92 3300044658 Ga0466972_0029215 Ga0466972_0029215_1354_2571 368
93 3300044683 Ga0466965_0001666 Ga0466965_0001666_5091_6308 368
94 3300044693 Ga0466961_0012871 Ga0466961_0012871_2918_4135 368
95 3300044694 Ga0466963_0098653 Ga0466963_0098653_221_1438 368
96 3300044719 Ga0466971_0019403 Ga0466971_0019403_708_1925 368
97 3300044765 Ga0466970_0005591 Ga0466970_0005591_865_2082 368
98 3300044842 Ga0466957_0001696 Ga0466957_0001696_1389_2606 368
99 3300045976 Ga0466967_0035008 Ga0466967_0035008_1556_2773 368
100 3300048908 Ga0496105_0073011 Ga0496105_0073011_493_1722 368
101 3300048917 Ga0496114_0015932 Ga0496114_0015932_3435_4664 368
102 3300061719 Ga0466962_0018943 Ga0466962_0018943_2077_3294 368
103 3300044684 Ga0466966_0066038 Ga0466966_0066038_39_1277 369
104 3300044901 Ga0466960_0017270 Ga0466960_0017270_739_1977 369
105 3300005985 Ga0081539_10073818 Ga0081539_100738182 372
106 3300006038 Ga0075365_10215115 Ga0075365_102151151 372
107 3300006353 Ga0075370_10072736 Ga0075370_100727362 372
108 iso_pu_bacteria 2773857762 2774393331 373
109 iso_pu_bacteria 2808606439 2809195781 373
110 iso_pu_bacteria 2811994878 2812350681 373
111 iso_pu_bacteria 2738541305 2738869723 374
112 iso_pu_bacteria 2891968417 2891971717 374
113 3300050491 nmdc:mga00v17_49287_c1 nmdc:mga00v17_49287_c1_377_1597 375
114 iso_pu_bacteria 2643221641 2644230230 375
115 3300048917 Ga0496114_0095162 Ga0496114_0095162_486_1823 376
116 3300037312 Ga0395899_0027415 Ga0395899_0027415_2959_4209 377
117 3300044684 Ga0466966_0113177 Ga0466966_0113177_251_1501 377
118 3300044693 Ga0466961_0006514 Ga0466961_0006514_91_1341 377
119 3300044694 Ga0466963_0002050 Ga0466963_0002050_119_1369 377
120 3300045049 Ga0466959_0020696 Ga0466959_0020696_3433_4683 377
121 3300049568 Ga0501031_0030509 Ga0501031_0030509_502_1773 377
122 3300049580 Ga0501046_0149771 Ga0501046_0149771_168_1433 377
123 3300061719 Ga0466962_0024944 Ga0466962_0024944_118_1368 377
124 iso_pu_bacteria 2643221576 2643888932 377
125 iso_pu_bacteria 2643221590 2643957987 377
126 iso_pu_bacteria 2643221617 2644098819 377
127 iso_pu_bacteria 2643221620 2644114700 377
128 iso_pu_bacteria 2857481737 2857482609 377
129 iso_pu_bacteria 2643221604 2644034478 378
130 3300002077 JGI24744J21845_10004886 JGI24744J21845_100048862 379
131 3300005329 Ga0070683_100030063 Ga0070683_1000300634 379
132 3300005331 Ga0070670_100139410 Ga0070670_1001394102 379
133 3300005337 Ga0070682_100013164 Ga0070682_1000131642 379
134 3300005338 Ga0068868_100090459 Ga0068868_1000904592 379
135 3300005345 Ga0070692_10007931 Ga0070692_100079314 379
136 3300005356 Ga0070674_100031653 Ga0070674_1000316533 379
137 3300005441 Ga0070700_100006129 Ga0070700_1000061292 379
138 3300005543 Ga0070672_100094102 Ga0070672_1000941022 379
139 3300005615 Ga0070702_100099416 Ga0070702_1000994162 379
140 3300005618 Ga0068864_100101850 Ga0068864_1001018502 379
141 3300005718 Ga0068866_10037617 Ga0068866_100376172 379
142 3300005719 Ga0068861_100061485 Ga0068861_1000614851 379
143 3300005840 Ga0068870_10003400 Ga0068870_100034002 379
144 3300006881 Ga0068865_100015883 Ga0068865_1000158831 379
145 3300009094 Ga0111539_10111851 Ga0111539_101118512 379
146 3300009148 Ga0105243_10005504 Ga0105243_100055042 379
147 3300009553 Ga0105249_10148135 Ga0105249_101481352 379
148 3300014326 Ga0157380_10037137 Ga0157380_100371372 379
149 3300014745 Ga0157377_10010067 Ga0157377_100100674 379
150 3300025901 Ga0207688_10009829 Ga0207688_100098292 379
151 3300025908 Ga0207643_10006219 Ga0207643_100062192 379
152 3300025932 Ga0207690_10112977 Ga0207690_101129772 379
153 3300025935 Ga0207709_10014292 Ga0207709_100142922 379
154 3300025937 Ga0207669_10022362 Ga0207669_100223622 379
155 3300025940 Ga0207691_10046173 Ga0207691_100461732 379
156 3300026075 Ga0207708_10000492 Ga0207708_1000049217 379
157 3300026118 Ga0207675_100159106 Ga0207675_1001591061 379
158 3300048911 Ga0496108_0158158 Ga0496108_0158158_497_1732 379
159 iso_pu_bacteria 2811994874 2812332438 379
160 3300044684 Ga0466966_0037881 Ga0466966_0037881_433_1674 381
161 3300044693 Ga0466961_0049849 Ga0466961_0049849_763_2004 381
162 3300044694 Ga0466963_0102270 Ga0466963_0102270_220_1461 381
163 3300044706 Ga0466964_0010371 Ga0466964_0010371_1191_2432 381
164 3300044842 Ga0466957_0005868 Ga0466957_0005868_5278_6519 381
165 3300044842 Ga0466957_0008325 Ga0466957_0008325_3367_4608 381
166 3300045976 Ga0466967_0014863 Ga0466967_0014863_4706_5947 381
167 iso_pu_bacteria 2855386786 2855387864 381
168 iso_pu_bacteria 8054609563 8054611086 381
169 3300005471 Ga0070698_100005020 Ga0070698_1000050206 382
170 3300006038 Ga0075365_10014404 Ga0075365_100144044 382
171 3300048903 Ga0496100_0042713 Ga0496100_0042713_1528_2778 382
172 3300053117 Ga0500593_001097 Ga0500593_001097_179_1429 382
173 iso_pu_bacteria 2643221615 2644089531 382
174 iso_pu_bacteria 2643221657 2644319376 382
175 3300000549 LJQas_1000744 LJQas_10007443 383
176 3300031852 Ga0307410_10088495 Ga0307410_100884952 383
177 3300031995 Ga0307409_100002934 Ga0307409_1000029345 383
178 3300032126 Ga0307415_100010101 Ga0307415_1000101014 383
179 3300032126 Ga0307415_100041332 Ga0307415_1000413322 383
180 3300032126 Ga0307415_100066768 Ga0307415_1000667682 383

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nc6-assembly2.cif.gz_B lipid ii flippase murj, inward closed conformation 0.7495 7 362
6nc6-assembly2.cif.gz_B lipid ii flippase murj, inward closed conformation 0.7027 7 362
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.6978 3 377
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.6835 3 377
7waw-assembly1.cif.gz_A murj inward closed form 0.6773 7 370
ID Description Score Start End Superfamily
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6963 258 370 1.20.1070.10
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6127 258 370 1.20.1070.10
af_Q54TT3_40_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4573 15 168 1.20.1250.20
af_O05884_25_249_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4337 11 214 1.20.1250.20
af_O06171_250_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4052 16 173 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6J4LR59-F1-model_v4 Capsular polysaccharide biosynthesis protein 0.9397 1 374 GO:0005886
AF-A0A4Q2SZF4-F1-model_v4 Polysaccharide biosynthesis protein 0.9366 2 378 GO:0005886
AF-A0A4Q2SZF4-F1-model_v4 Polysaccharide biosynthesis protein 0.9201 2 378 GO:0005886
AF-A0A5C4M3D6-F1-model_v4 Polysaccharide biosynthesis protein 0.9168 2 365 GO:0005886
AF-A0A6J4LR59-F1-model_v4 Capsular polysaccharide biosynthesis protein 0.916 1 374 GO:0005886

Feature Viewer

pLDDT pTM Quality
80.59 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map