F275405

General Info

Members Datasets Scaffolds Average Seq Length
180 76 360 162

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100485332|Ga0075431_1004853322
Length 171
Sequence MSKRSRTRGARPTVMTRPLWTCPKCGAKLVTRNMWHSCGRATLSEWKARMGPRARALYDRFEEMVAACGEYHVAPAKTRIAFLGRVRFAGITRLSEDGMTCSFALPSPVASARFRFRFIRVEEIVPGWWVHWLHVTEPSQLDARCQAWIRRSYRLMGQQQRLLGRKLRTKN

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
32 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
33 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
34 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
35 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
36 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
37 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
38 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
39 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
40 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
42 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
43 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
44 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
45 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
50 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
51 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
52 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
53 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
54 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
55 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
56 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
57 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
58 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
59 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
60 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
61 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
62 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
63 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
64 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
67 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
68 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
69 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
70 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
71 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
72 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
73 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
74 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
75 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
76 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 21.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100485332 3300006847 Bacteria 1228
2 Ga0065707_10242665 3300005295 Bacteria 1150
3 Ga0070691_10572219 3300005341 Bacteria 663
4 Ga0070701_10297693 3300005438 Unclassified 991
5 Ga0070705_100089445 3300005440 Bacteria 1914
6 Ga0070694_100135118 3300005444 Bacteria 1786
7 Ga0070707_100002282 3300005468 Bacteria 18326
8 Ga0070698_100096085 3300005471 Unclassified 2940
9 Ga0070698_100451161 3300005471 Bacteria 1222
10 Ga0070699_100209178 3300005518 Unclassified 1736
11 Ga0070699_100438755 3300005518 Bacteria 1183
12 Ga0070697_100061985 3300005536 Unclassified 3051
13 Ga0070686_100591301 3300005544 Bacteria 873
14 Ga0070696_100504231 3300005546 Unclassified 963
15 Ga0070696_102009331 3300005546 Unclassified 502
16 Ga0070704_100071087 3300005549 Bacteria 2527
17 Ga0070704_100547947 3300005549 Bacteria 1010
18 Ga0081455_10002431 3300005937 Bacteria 22211
19 Ga0081455_10007894 3300005937 Bacteria 11137
20 Ga0081455_10011350 3300005937 Bacteria 8959
21 Ga0081455_10015323 3300005937 Bacteria 7454
22 Ga0081455_10375965 3300005937 Bacteria 994
23 Ga0081538_10012246 3300005981 Bacteria 6889
24 Ga0075428_100029955 3300006844 Bacteria 6020
25 Ga0075428_100033458 3300006844 Bacteria 5676
26 Ga0075428_100186793 3300006844 Bacteria 2242
27 Ga0075428_100607917 3300006844 Archaea 1167
28 Ga0075428_100802486 3300006844 Bacteria 1000
29 Ga0075430_100017706 3300006846 Bacteria 6066
30 Ga0075430_100070591 3300006846 Bacteria 2930
31 Ga0075430_100089590 3300006846 Bacteria 2574
32 Ga0075430_100094674 3300006846 Bacteria 2497
33 Ga0075430_100177069 3300006846 Bacteria 1774
34 Ga0075430_100252515 3300006846 Unclassified 1461
35 Ga0075430_100390013 3300006846 Unclassified 1149
36 Ga0075431_100059007 3300006847 Bacteria 3960
37 Ga0075431_100091599 3300006847 Unclassified 3138
38 Ga0075431_100153852 3300006847 Unclassified 2367
39 Ga0075431_100242394 3300006847 Bacteria 1833
40 Ga0075431_100270629 3300006847 Bacteria 1721
41 Ga0075431_100291527 3300006847 Bacteria 1650
42 Ga0075431_100639531 3300006847 Unclassified 1045
43 Ga0075433_10117156 3300006852 Bacteria 2363
44 Ga0075433_10204936 3300006852 Unclassified 1753
45 Ga0075433_10549627 3300006852 Bacteria 1015
46 Ga0075434_100017554 3300006871 Bacteria 6897
47 Ga0075429_100010367 3300006880 Bacteria 8064
48 Ga0075429_100138621 3300006880 Bacteria 2129
49 Ga0075429_100193315 3300006880 Bacteria 1782
50 Ga0075429_100219189 3300006880 Unclassified 1667
51 Ga0075436_100468636 3300006914 Unclassified 919
52 Ga0111539_10001214 3300009094 Bacteria 34314
53 Ga0111539_10118958 3300009094 Bacteria 3096
54 Ga0114129_10002238 3300009147 Bacteria 26708
55 Ga0114129_10003170 3300009147 Bacteria 23075
56 Ga0114129_10031407 3300009147 Bacteria 7507
57 Ga0114129_10050974 3300009147 Bacteria 5812
58 Ga0114129_10061003 3300009147 Bacteria 5272
59 Ga0114129_10415390 3300009147 Bacteria 1771
60 Ga0114129_11704215 3300009147 Unclassified 769
61 Ga0207684_10001002 3300025910 Bacteria 31689
62 Ga0207646_10022340 3300025922 Bacteria 5830
63 Ga0207428_10001742 3300027907 Bacteria 22287
64 Ga0207428_10003011 3300027907 Bacteria 16617
65 Ga0207428_11007962 3300027907 Unclassified 585
66 Ga0395900_0340166 3300037418 Bacteria 1476
67 Ga0395898_0803007 3300037466 Bacteria 881
68 Ga0395905_0330756 3300037471 Bacteria 1414
69 Ga0395901_0138466 3300038443 Bacteria 2558
70 Ga0395901_0645236 3300038443 Bacteria 1063
71 Ga0436363_1704233 3300039450 Bacteria 866
72 Ga0439435_0009603 3300042436 Bacteria 2274
73 Ga0439435_0086242 3300042436 Bacteria 948
74 Ga0439464_0035547 3300042439 Bacteria 1407
75 Ga0451577_1433715 3300042876 Unclassified 612
76 Ga0495675_0299622 3300047444 Unclassified 955
77 Ga0501299_002938 3300049522 Bacteria 2416
78 Ga0501031_0007062 3300049568 Bacteria 7328
79 Ga0501033_0043093 3300049570 Bacteria 3362
80 Ga0501036_0002941 3300049572 Bacteria 13530
81 Ga0501036_0035081 3300049572 Bacteria 4243
82 Ga0501037_0062163 3300049573 Unclassified 2722
83 Ga0501037_0122371 3300049573 Bacteria 1870
84 Ga0501037_0324140 3300049573 Bacteria 1066
85 Ga0501038_0004238 3300049574 Bacteria 13329
86 Ga0501038_0132633 3300049574 Bacteria 2043
87 Ga0501038_0315761 3300049574 Bacteria 1223
88 Ga0501039_0003161 3300049575 Bacteria 12320
89 Ga0501039_0336855 3300049575 Bacteria 1185
90 Ga0501040_0001313 3300049576 Bacteria 15756
91 Ga0501040_0017452 3300049576 Bacteria 4764
92 Ga0501040_0017528 3300049576 Unclassified 4753
93 Ga0501040_0117569 3300049576 Bacteria 1864
94 Ga0501041_0003587 3300049577 Bacteria 8926
95 Ga0501041_0040141 3300049577 Bacteria 2840
96 Ga0501041_0314905 3300049577 Unclassified 987
97 Ga0501042_0065441 3300049578 Bacteria 2597
98 Ga0501043_0050199 3300049579 Bacteria 3279
99 Ga0501046_0454731 3300049580 Unclassified 920
100 Ga0501048_0003409 3300049582 Bacteria 12078
101 Ga0501048_0010990 3300049582 Bacteria 6754
102 Ga0501068_0061498 3300049584 Bacteria 2282
103 Ga0501068_0098822 3300049584 Bacteria 1808
104 Ga0501070_0129705 3300049586 Bacteria 2083
105 Ga0501070_0147565 3300049586 Bacteria 1941
106 Ga0501070_0328706 3300049586 Bacteria 1243
107 Ga0501071_0025323 3300049587 Bacteria 4155
108 Ga0501071_0025779 3300049587 Bacteria 4120
109 Ga0501071_0058439 3300049587 Unclassified 2789
110 Ga0501071_0110104 3300049587 Bacteria 2035
111 Ga0501072_0003199 3300049588 Bacteria 12303
112 Ga0501072_0096736 3300049588 Bacteria 2346
113 Ga0501072_0202925 3300049588 Bacteria 1581
114 Ga0501072_1273074 3300049588 Bacteria 570
115 Ga0501073_0028417 3300049589 Bacteria 3996
116 Ga0501073_0064574 3300049589 Bacteria 2553
117 Ga0501074_0032049 3300049590 Bacteria 3810
118 Ga0501074_0109269 3300049590 Bacteria 1979
119 Ga0501074_0403437 3300049590 Bacteria 969
120 Ga0501075_0001336 3300049591 Bacteria 16012
121 Ga0501075_0005687 3300049591 Bacteria 8535
122 Ga0501075_0336566 3300049591 Bacteria 1150
123 Ga0501075_0799251 3300049591 Bacteria 718
124 Ga0501076_0002749 3300049592 Bacteria 12180
125 Ga0501076_0455748 3300049592 Bacteria 1053
126 Ga0501076_0577368 3300049592 Unclassified 927
127 Ga0501076_1015536 3300049592 Bacteria 683
128 Ga0501077_0002062 3300049593 Bacteria 12124
129 Ga0501077_0051009 3300049593 Bacteria 2629
130 Ga0501077_0222771 3300049593 Bacteria 1199
131 Ga0501077_0550522 3300049593 Unclassified 740
132 Ga0501233_037665 3300049668 Unclassified 1124
133 Ga0501079_0003119 3300049741 Bacteria 12140
134 Ga0501079_0290580 3300049741 Bacteria 1278
135 Ga0501079_1000683 3300049741 Unclassified 658
136 Ga0501080_0396825 3300049742 Bacteria 1241
137 Ga0501081_0180766 3300049743 Bacteria 1525
138 Ga0501081_0267651 3300049743 Bacteria 1250
139 Ga0501081_0369765 3300049743 Unclassified 1058
140 Ga0501083_0105701 3300049744 Bacteria 1853
141 Ga0501281_06346 3300049777 Unclassified 829
142 Ga0501283_019181 3300049779 Unclassified 1081
143 Ga0501035_0214354 3300049822 Unclassified 1646
144 Ga0501035_0932549 3300049822 Bacteria 686
145 Ga0501045_0002631 3300049824 Bacteria 12236
146 Ga0501045_0011801 3300049824 Bacteria 6138
147 Ga0501045_0588644 3300049824 Unclassified 824
148 nmdc:mga05p37_109939_c1 3300050507 Unclassified 3391
149 nmdc:mga05p37_136424_c1 3300050507 Unclassified 3008
150 nmdc:mga05p37_191_c1 3300050507 Bacteria 61045
151 nmdc:mga05p37_285905_c1 3300050507 Bacteria 1965
152 nmdc:mga05p37_545_c1 3300050507 Bacteria 41442
153 nmdc:mga05p37_8013_c1 3300050507 Bacteria 12471
154 nmdc:mga09592_459584_c1 3300050508 Unclassified 1098
155 nmdc:mga09592_47278_c1 3300050508 Bacteria 3627
156 nmdc:mga0qj67_138157_c1 3300050509 Bacteria 1975
157 nmdc:mga0qj67_5304_c1 3300050509 Bacteria 9406
158 nmdc:mga06r32_131752_c1 3300050510 Bacteria 2472
159 nmdc:mga06r32_1926_c1 3300050510 Bacteria 18495
160 nmdc:mga06r32_20217_c1 3300050510 Bacteria 6126
161 nmdc:mga06r32_573052_c1 3300050510 Unclassified 1101
162 nmdc:mga08y16_141030_c1 3300050511 Bacteria 2506
163 nmdc:mga08y16_70727_c1 3300050511 Bacteria 3637
164 nmdc:mga08y16_9813_c1 3300050511 Bacteria 10049
165 nmdc:mga0a205_149490_c1 3300050515 Bacteria 2236
166 Ga0495601_0079337 3300053077 Bacteria 2105
167 Ga0501084_0095516 3300054114 Bacteria 2496
168 Ga0501084_0120463 3300054114 Bacteria 2206
169 Ga0501084_0327619 3300054114 Bacteria 1294
170 Ga0501084_0401417 3300054114 Bacteria 1158
171 Ga0501084_0808507 3300054114 Bacteria 789
172 Ga0501082_0003315 3300060353 Bacteria 14056
173 Ga0501082_0127158 3300060353 Bacteria 2210
174 Ga0501082_0300142 3300060353 Bacteria 1399
175 Ga0501082_0377498 3300060353 Unclassified 1237
176 Ga0501082_0516242 3300060353 Bacteria 1044
177 Ga0501082_1128094 3300060353 Bacteria 685
178 Ga0530510_0002642 3300061734 Bacteria 12320
179 Ga0530510_0043594 3300061734 Bacteria 3241
180 Ga0530510_1231480 3300061734 Unclassified 574
181 Ga0075431_100485332
182 Ga0065707_10242665
183 Ga0070691_10572219
184 Ga0070701_10297693
185 Ga0070705_100089445
186 Ga0070694_100135118
187 Ga0070707_100002282
188 Ga0070698_100096085
189 Ga0070698_100451161
190 Ga0070699_100209178
191 Ga0070699_100438755
192 Ga0070697_100061985
193 Ga0070686_100591301
194 Ga0070696_100504231
195 Ga0070696_102009331
196 Ga0070704_100071087
197 Ga0070704_100547947
198 Ga0081455_10002431
199 Ga0081455_10007894
200 Ga0081455_10011350
201 Ga0081455_10015323
202 Ga0081455_10375965
203 Ga0081538_10012246
204 Ga0075428_100029955
205 Ga0075428_100033458
206 Ga0075428_100186793
207 Ga0075428_100607917
208 Ga0075428_100802486
209 Ga0075430_100017706
210 Ga0075430_100070591
211 Ga0075430_100089590
212 Ga0075430_100094674
213 Ga0075430_100177069
214 Ga0075430_100252515
215 Ga0075430_100390013
216 Ga0075431_100059007
217 Ga0075431_100091599
218 Ga0075431_100153852
219 Ga0075431_100242394
220 Ga0075431_100270629
221 Ga0075431_100291527
222 Ga0075431_100639531
223 Ga0075433_10117156
224 Ga0075433_10204936
225 Ga0075433_10549627
226 Ga0075434_100017554
227 Ga0075429_100010367
228 Ga0075429_100138621
229 Ga0075429_100193315
230 Ga0075429_100219189
231 Ga0075436_100468636
232 Ga0111539_10001214
233 Ga0111539_10118958
234 Ga0114129_10002238
235 Ga0114129_10003170
236 Ga0114129_10031407
237 Ga0114129_10050974
238 Ga0114129_10061003
239 Ga0114129_10415390
240 Ga0114129_11704215
241 Ga0207684_10001002
242 Ga0207646_10022340
243 Ga0207428_10001742
244 Ga0207428_10003011
245 Ga0207428_11007962
246 Ga0395900_0340166
247 Ga0395898_0803007
248 Ga0395905_0330756
249 Ga0395901_0138466
250 Ga0395901_0645236
251 Ga0436363_1704233
252 Ga0439435_0009603
253 Ga0439435_0086242
254 Ga0439464_0035547
255 Ga0451577_1433715
256 Ga0495675_0299622
257 Ga0501299_002938
258 Ga0501031_0007062
259 Ga0501033_0043093
260 Ga0501036_0002941
261 Ga0501036_0035081
262 Ga0501037_0062163
263 Ga0501037_0122371
264 Ga0501037_0324140
265 Ga0501038_0004238
266 Ga0501038_0132633
267 Ga0501038_0315761
268 Ga0501039_0003161
269 Ga0501039_0336855
270 Ga0501040_0001313
271 Ga0501040_0017452
272 Ga0501040_0017528
273 Ga0501040_0117569
274 Ga0501041_0003587
275 Ga0501041_0040141
276 Ga0501041_0314905
277 Ga0501042_0065441
278 Ga0501043_0050199
279 Ga0501046_0454731
280 Ga0501048_0003409
281 Ga0501048_0010990
282 Ga0501068_0061498
283 Ga0501068_0098822
284 Ga0501070_0129705
285 Ga0501070_0147565
286 Ga0501070_0328706
287 Ga0501071_0025323
288 Ga0501071_0025779
289 Ga0501071_0058439
290 Ga0501071_0110104
291 Ga0501072_0003199
292 Ga0501072_0096736
293 Ga0501072_0202925
294 Ga0501072_1273074
295 Ga0501073_0028417
296 Ga0501073_0064574
297 Ga0501074_0032049
298 Ga0501074_0109269
299 Ga0501074_0403437
300 Ga0501075_0001336
301 Ga0501075_0005687
302 Ga0501075_0336566
303 Ga0501075_0799251
304 Ga0501076_0002749
305 Ga0501076_0455748
306 Ga0501076_0577368
307 Ga0501076_1015536
308 Ga0501077_0002062
309 Ga0501077_0051009
310 Ga0501077_0222771
311 Ga0501077_0550522
312 Ga0501233_037665
313 Ga0501079_0003119
314 Ga0501079_0290580
315 Ga0501079_1000683
316 Ga0501080_0396825
317 Ga0501081_0180766
318 Ga0501081_0267651
319 Ga0501081_0369765
320 Ga0501083_0105701
321 Ga0501281_06346
322 Ga0501283_019181
323 Ga0501035_0214354
324 Ga0501035_0932549
325 Ga0501045_0002631
326 Ga0501045_0011801
327 Ga0501045_0588644
328 nmdc:mga05p37_109939_c1
329 nmdc:mga05p37_136424_c1
330 nmdc:mga05p37_191_c1
331 nmdc:mga05p37_285905_c1
332 nmdc:mga05p37_545_c1
333 nmdc:mga05p37_8013_c1
334 nmdc:mga09592_459584_c1
335 nmdc:mga09592_47278_c1
336 nmdc:mga0qj67_138157_c1
337 nmdc:mga0qj67_5304_c1
338 nmdc:mga06r32_131752_c1
339 nmdc:mga06r32_1926_c1
340 nmdc:mga06r32_20217_c1
341 nmdc:mga06r32_573052_c1
342 nmdc:mga08y16_141030_c1
343 nmdc:mga08y16_70727_c1
344 nmdc:mga08y16_9813_c1
345 nmdc:mga0a205_149490_c1
346 Ga0495601_0079337
347 Ga0501084_0095516
348 Ga0501084_0120463
349 Ga0501084_0327619
350 Ga0501084_0401417
351 Ga0501084_0808507
352 Ga0501082_0003315
353 Ga0501082_0127158
354 Ga0501082_0300142
355 Ga0501082_0377498
356 Ga0501082_0516242
357 Ga0501082_1128094
358 Ga0530510_0002642
359 Ga0530510_0043594
360 Ga0530510_1231480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18899

DUF5655

Domain of unknown function (DUF5655)

45

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hu2-assembly1.cif.gz_A sugar kinases from synechococcus elongatus pcc7942-t11a 0.6509 83 123
3qdk-assembly1.cif.gz_A structural insight on mechanism and diverse substrate selection strategy of ribulokinase 0.6278 73 123
7z0q-assembly1.cif.gz_D mhc-ii dynamics are maintained in hla-dr allotypes to ensure catalyzed peptide exchange 0.5908 76 118
6jow-assembly2.cif.gz_D exo-beta-d-glucosaminidase from pyrococcus furiosus 0.5852 76 120
3bku-assembly2.cif.gz_A apo c-terminal domain of nikr 0.5805 86 123
ID Description Score Start End Superfamily
af_A0A1D6NF37_93_244_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6707 84 117 1.10.510.10
3ll3B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6669 74 114 3.30.420.40
af_F1QE54_397_495_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6545 76 117 2.60.40.10
af_P42826_310_571_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6535 83 121 3.30.420.40
af_Q9VPT2_295_563_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6477 75 116 3.30.420.40
ID Description Score Start End GO Terms
AF-R9MCD3-F1-model_v4 DUF5655 domain-containing protein 0.9689 84 137
AF-A0A7T9AX95-F1-model_v4 deleted 0.968 84 137
AF-A0A2V8LAR1-F1-model_v4 DUF5655 domain-containing protein 0.9647 75 139
AF-A0A2V8L8K7-F1-model_v4 DUF5655 domain-containing protein 0.962 73 138
AF-A0A1F8QA30-F1-model_v4 DUF5655 domain-containing protein 0.9618 85 139

Map