F275300

General Info

Members Datasets Scaffolds Average Seq Length
180 103 360 307

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100024103|Ga0068860_1000241032
Length 343
Sequence MNNNIILKKFQNCYETLMWRGLQATFPRKEPVLRLPKGVGLILLLFLTIPSGCKQEDTTNDDAVTTETHTPVTVTSINYDPIEEFIELNATSAFLQKSYVKSNLTGYVKKVNIKLGDFVNNGQTLFVLKTKEAEAIGNSVNHLNPDFKFSGVNTIPANIHGFIAELNHQEGDYVQDGEQLAVISDSKSFVFIMNVPYEYRPYVSIGKQVEVTLPDHEHLQGTVQSVMPMIDSLSQTQSVALRVNLPHTIPQNLVAKVKIVKVSKVTASSLPKKAILSNETLSEFWVMKMINDTTAIKVPVKTGIETGERIEIVSPNFSPQDKILLSGNYGLPDTALVIVQKSN

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
94 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
95 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
96 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
97 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
98 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
99 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
102 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
103 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 0
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100024103 3300005843 Bacteria 5882
2 rootL2_10135861 3300003322 Bacteria 4532
3 rootH1_10188025 3300003323 Bacteria 1808
4 Ga0055535_1003011 3300003761 Bacteria 5150
5 Ga0065714_10002411 3300005288 Bacteria 34982
6 Ga0065714_10066157 3300005288 Bacteria 7464
7 Ga0065714_10093613 3300005288 Bacteria 1841
8 Ga0065704_10163103 3300005289 Bacteria 1341
9 Ga0070658_10024224 3300005327 Bacteria 4870
10 Ga0070658_10075291 3300005327 Bacteria 2769
11 Ga0070658_10402271 3300005327 Bacteria 1176
12 Ga0070683_100087966 3300005329 Bacteria 2914
13 Ga0070666_10016178 3300005335 Bacteria 4769
14 Ga0070680_100019282 3300005336 Bacteria 5405
15 Ga0070680_100146312 3300005336 Bacteria 1982
16 Ga0070682_100000041 3300005337 Bacteria 142152
17 Ga0070660_100000807 3300005339 Bacteria 20768
18 Ga0070660_100003855 3300005339 Bacteria 10354
19 Ga0070660_100186452 3300005339 Unclassified 1680
20 Ga0070692_10106804 3300005345 Bacteria 1543
21 Ga0070659_100005269 3300005366 Bacteria 9281
22 Ga0070659_100145125 3300005366 Bacteria 1933
23 Ga0070659_100203520 3300005366 Bacteria 1630
24 Ga0070663_100054332 3300005455 Bacteria 2862
25 Ga0070681_10029312 3300005458 Bacteria 5526
26 Ga0070681_10037512 3300005458 Bacteria 4862
27 Ga0070681_10150872 3300005458 Bacteria 2250
28 Ga0070679_100012640 3300005530 Bacteria 8075
29 Ga0070679_100111226 3300005530 Bacteria 2725
30 Ga0070679_100262220 3300005530 Bacteria 1683
31 Ga0068853_100141242 3300005539 Bacteria 2162
32 Ga0068853_100616637 3300005539 Bacteria 1031
33 Ga0068855_100048374 3300005563 Bacteria 5019
34 Ga0068855_100136152 3300005563 Bacteria 2803
35 Ga0068855_100194236 3300005563 Bacteria 2287
36 Ga0068857_100101364 3300005577 Bacteria 2584
37 Ga0068856_100012387 3300005614 Bacteria 8259
38 Ga0068856_100044946 3300005614 Unclassified 4347
39 Ga0068856_100369109 3300005614 Bacteria 1454
40 Ga0068852_100106583 3300005616 Bacteria 2541
41 Ga0068852_100332817 3300005616 Bacteria 1478
42 Ga0068863_100033943 3300005841 Bacteria 4861
43 Ga0068860_100012364 3300005843 Bacteria 8410
44 Ga0070716_100079165 3300006173 Unclassified 1956
45 Ga0097621_100163283 3300006237 Bacteria 1916
46 Ga0097621_100304091 3300006237 Bacteria 1409
47 Ga0097621_100411384 3300006237 Bacteria 1212
48 Ga0068871_100193925 3300006358 Bacteria 1751
49 Ga0105241_10143844 3300009174 Bacteria 1944
50 Ga0105237_10104108 3300009545 Bacteria 2830
51 Ga0105239_10089201 3300010375 Bacteria 3400
52 Ga0157373_10000156 3300013100 Bacteria 55108
53 Ga0157373_10000377 3300013100 Bacteria 35725
54 Ga0157373_10007532 3300013100 Bacteria 8093
55 Ga0157373_10017450 3300013100 Bacteria 5227
56 Ga0157373_10194648 3300013100 Bacteria 1429
57 Ga0157371_10000401 3300013102 Bacteria 54323
58 Ga0157371_10001694 3300013102 Bacteria 22441
59 Ga0157371_10002594 3300013102 Bacteria 17154
60 Ga0157371_10006087 3300013102 Bacteria 10033
61 Ga0157371_10007435 3300013102 Bacteria 8869
62 Ga0157371_10008399 3300013102 Bacteria 8229
63 Ga0157371_10035754 3300013102 Bacteria 3559
64 Ga0157371_10167576 3300013102 Bacteria 1569
65 Ga0157371_10274102 3300013102 Bacteria 1218
66 Ga0157370_10000743 3300013104 Bacteria 40731
67 Ga0157370_10007850 3300013104 Bacteria 11563
68 Ga0157370_10033025 3300013104 Bacteria 5047
69 Ga0157370_10436589 3300013104 Bacteria 1204
70 Ga0157369_10033855 3300013105 Bacteria 5611
71 Ga0157369_10057757 3300013105 Bacteria 4185
72 Ga0157369_10411350 3300013105 Unclassified 1403
73 Ga0157374_10269270 3300013296 Bacteria 1679
74 Ga0163162_10343919 3300013306 Unclassified 1624
75 Ga0163162_10408114 3300013306 Bacteria 1491
76 Ga0157372_10008207 3300013307 Bacteria 11099
77 Ga0157372_10051512 3300013307 Unclassified 4582
78 Ga0157372_10073149 3300013307 Bacteria 3863
79 Ga0157372_10162902 3300013307 Bacteria 2578
80 Ga0157372_10370290 3300013307 Bacteria 1669
81 Ga0157372_10418196 3300013307 Bacteria 1562
82 Ga0157372_10487610 3300013307 Bacteria 1437
83 Ga0157375_10702863 3300013308 Bacteria 1164
84 Ga0163163_10154859 3300014325 Bacteria 2336
85 Ga0157376_10024269 3300014969 Bacteria 4757
86 Ga0209258_100151 3300025242 Bacteria 160444
87 Ga0209148_1000154 3300025254 Bacteria 145214
88 Ga0207680_10099590 3300025903 Bacteria 1865
89 Ga0207647_10021731 3300025904 Bacteria 4277
90 Ga0207647_10078830 3300025904 Unclassified 1978
91 Ga0207705_10014603 3300025909 Bacteria 5652
92 Ga0207654_10094584 3300025911 Bacteria 1829
93 Ga0207707_10041431 3300025912 Bacteria 4022
94 Ga0207707_10093754 3300025912 Bacteria 2623
95 Ga0207707_10227495 3300025912 Bacteria 1623
96 Ga0207660_10002176 3300025917 Bacteria 12988
97 Ga0207660_10151389 3300025917 Bacteria 1782
98 Ga0207657_10002612 3300025919 Bacteria 19465
99 Ga0207657_10031469 3300025919 Bacteria 4805
100 Ga0207657_10080632 3300025919 Bacteria 2735
101 Ga0207652_10000074 3300025921 Bacteria 108397
102 Ga0207652_10000831 3300025921 Bacteria 29402
103 Ga0207652_10031882 3300025921 Bacteria 4426
104 Ga0207652_10056344 3300025921 Bacteria 3384
105 Ga0207690_10055102 3300025932 Bacteria 2676
106 Ga0207667_10057088 3300025949 Bacteria 4099
107 Ga0207667_10072151 3300025949 Bacteria 3589
108 Ga0207667_10074651 3300025949 Bacteria 3522
109 Ga0207667_10235290 3300025949 Unclassified 1875
110 Ga0207667_10436231 3300025949 Bacteria 1332
111 Ga0207639_10006336 3300026041 Bacteria 8034
112 Ga0207678_10055063 3300026067 Bacteria 3426
113 Ga0207702_10071036 3300026078 Bacteria 2996
114 Ga0207702_10092398 3300026078 Bacteria 2652
115 Ga0207702_10140194 3300026078 Bacteria 2187
116 Ga0207676_10023303 3300026095 Bacteria 4566
117 Ga0207676_10209910 3300026095 Bacteria 1727
118 Ga0207674_10153730 3300026116 Bacteria 2257
119 Ga0207698_10202792 3300026142 Bacteria 1778
120 Ga0268264_10011314 3300028381 Bacteria 7372
121 Ga0268264_10106472 3300028381 Unclassified 2448
122 Ga0265323_10000625 3300028653 Bacteria 19350
123 Ga0307515_10000016 3300028794 Bacteria 554870
124 Ga0265338_10067875 3300028800 Bacteria 3076
125 Ga0265327_10054372 3300031251 Bacteria 2073
126 Ga0265316_10001903 3300031344 Bacteria 21927
127 Ga0307509_10046600 3300031507 Unclassified 4667
128 Ga0307514_10108418 3300031649 Bacteria 1975
129 Ga0307414_10001669 3300032004 Bacteria 11539
130 Ga0395899_0008944 3300037312 Bacteria 7706
131 Ga0395899_0047812 3300037312 Bacteria 3184
132 Ga0395899_0093437 3300037312 Bacteria 2177
133 Ga0395899_0097376 3300037312 Unclassified 2127
134 Ga0395900_0000203 3300037418 Bacteria 93536
135 Ga0395900_0004379 3300037418 Bacteria 14982
136 Ga0395900_0026031 3300037418 Bacteria 5990
137 Ga0395900_0034996 3300037418 Bacteria 5172
138 Ga0395900_0042696 3300037418 Bacteria 4672
139 Ga0395898_0001285 3300037466 Bacteria 36916
140 Ga0395898_0028319 3300037466 Bacteria 5615
141 Ga0395901_0007085 3300038443 Bacteria 11332
142 Ga0395901_0037167 3300038443 Bacteria 5037
143 Ga0395901_0054599 3300038443 Bacteria 4152
144 Ga0395901_0105100 3300038443 Bacteria 2963
145 Ga0395901_0184455 3300038443 Bacteria 2188
146 Ga0395901_0236357 3300038443 Bacteria 1907
147 Ga0436365_1179973 3300039437 Bacteria 33661
148 Ga0451577_0099028 3300042876 Bacteria 2604
149 Ga0453684_0276673 3300044712 Unclassified 1916
150 Ga0451576_0012824 3300045051 Bacteria 9405
151 Ga0495592_0064998 3300046454 Bacteria 2672
152 Ga0495650_0000198 3300046471 Bacteria 130455
153 Ga0495606_0006183 3300046507 Bacteria 11144
154 Ga0495606_0020878 3300046507 Bacteria 4812
155 Ga0495616_0001278 3300046513 Bacteria 17673
156 Ga0495648_0035728 3300046524 Bacteria 3218
157 Ga0495636_0000008 3300047318 Bacteria 102958
158 Ga0501032_0071107 3300049569 Bacteria 2319
159 Ga0501034_0013586 3300049571 Bacteria 8379
160 Ga0501038_0100588 3300049574 Bacteria 2408
161 Ga0501043_0008668 3300049579 Bacteria 8005
162 Ga0501047_0008865 3300049581 Bacteria 9489
163 Ga0501070_0085646 3300049586 Bacteria 2609
164 Ga0501073_0002835 3300049589 Bacteria 12993
165 Ga0501074_0022538 3300049590 Bacteria 4576
166 Ga0501080_0041986 3300049742 Bacteria 4260
167 Ga0501083_0100730 3300049744 Unclassified 1905
168 Ga0501035_0111718 3300049822 Unclassified 2394
169 Ga0501044_0049407 3300049823 Unclassified 4343
170 Ga0500644_0000133 3300053088 Bacteria 45875
171 Ga0500583_0004733 3300053092 Unclassified 4477
172 Ga0500651_0004228 3300053093 Bacteria 8013
173 Ga0500569_004412 3300053109 Unclassified 2954
174 Ga0500607_105088 3300053121 Unclassified 1395
175 Ga0500658_0007937 3300053134 Bacteria 3922
176 Ga0500577_0000567 3300053142 Bacteria 9556
177 Ga0500616_0036231 3300053153 Unclassified 2678
178 2776612553 2775506987 Bacteria 5373360
179 2852625696 2852623160 Bacteria 4376875
180 2852628285 2852627209 Bacteria 5896285
181 Ga0068860_100024103
182 rootL2_10135861
183 rootH1_10188025
184 Ga0055535_1003011
185 Ga0065714_10002411
186 Ga0065714_10066157
187 Ga0065714_10093613
188 Ga0065704_10163103
189 Ga0070658_10024224
190 Ga0070658_10075291
191 Ga0070658_10402271
192 Ga0070683_100087966
193 Ga0070666_10016178
194 Ga0070680_100019282
195 Ga0070680_100146312
196 Ga0070682_100000041
197 Ga0070660_100000807
198 Ga0070660_100003855
199 Ga0070660_100186452
200 Ga0070692_10106804
201 Ga0070659_100005269
202 Ga0070659_100145125
203 Ga0070659_100203520
204 Ga0070663_100054332
205 Ga0070681_10029312
206 Ga0070681_10037512
207 Ga0070681_10150872
208 Ga0070679_100012640
209 Ga0070679_100111226
210 Ga0070679_100262220
211 Ga0068853_100141242
212 Ga0068853_100616637
213 Ga0068855_100048374
214 Ga0068855_100136152
215 Ga0068855_100194236
216 Ga0068857_100101364
217 Ga0068856_100012387
218 Ga0068856_100044946
219 Ga0068856_100369109
220 Ga0068852_100106583
221 Ga0068852_100332817
222 Ga0068863_100033943
223 Ga0068860_100012364
224 Ga0070716_100079165
225 Ga0097621_100163283
226 Ga0097621_100304091
227 Ga0097621_100411384
228 Ga0068871_100193925
229 Ga0105241_10143844
230 Ga0105237_10104108
231 Ga0105239_10089201
232 Ga0157373_10000156
233 Ga0157373_10000377
234 Ga0157373_10007532
235 Ga0157373_10017450
236 Ga0157373_10194648
237 Ga0157371_10000401
238 Ga0157371_10001694
239 Ga0157371_10002594
240 Ga0157371_10006087
241 Ga0157371_10007435
242 Ga0157371_10008399
243 Ga0157371_10035754
244 Ga0157371_10167576
245 Ga0157371_10274102
246 Ga0157370_10000743
247 Ga0157370_10007850
248 Ga0157370_10033025
249 Ga0157370_10436589
250 Ga0157369_10033855
251 Ga0157369_10057757
252 Ga0157369_10411350
253 Ga0157374_10269270
254 Ga0163162_10343919
255 Ga0163162_10408114
256 Ga0157372_10008207
257 Ga0157372_10051512
258 Ga0157372_10073149
259 Ga0157372_10162902
260 Ga0157372_10370290
261 Ga0157372_10418196
262 Ga0157372_10487610
263 Ga0157375_10702863
264 Ga0163163_10154859
265 Ga0157376_10024269
266 Ga0209258_100151
267 Ga0209148_1000154
268 Ga0207680_10099590
269 Ga0207647_10021731
270 Ga0207647_10078830
271 Ga0207705_10014603
272 Ga0207654_10094584
273 Ga0207707_10041431
274 Ga0207707_10093754
275 Ga0207707_10227495
276 Ga0207660_10002176
277 Ga0207660_10151389
278 Ga0207657_10002612
279 Ga0207657_10031469
280 Ga0207657_10080632
281 Ga0207652_10000074
282 Ga0207652_10000831
283 Ga0207652_10031882
284 Ga0207652_10056344
285 Ga0207690_10055102
286 Ga0207667_10057088
287 Ga0207667_10072151
288 Ga0207667_10074651
289 Ga0207667_10235290
290 Ga0207667_10436231
291 Ga0207639_10006336
292 Ga0207678_10055063
293 Ga0207702_10071036
294 Ga0207702_10092398
295 Ga0207702_10140194
296 Ga0207676_10023303
297 Ga0207676_10209910
298 Ga0207674_10153730
299 Ga0207698_10202792
300 Ga0268264_10011314
301 Ga0268264_10106472
302 Ga0265323_10000625
303 Ga0307515_10000016
304 Ga0265338_10067875
305 Ga0265327_10054372
306 Ga0265316_10001903
307 Ga0307509_10046600
308 Ga0307514_10108418
309 Ga0307414_10001669
310 Ga0395899_0008944
311 Ga0395899_0047812
312 Ga0395899_0093437
313 Ga0395899_0097376
314 Ga0395900_0000203
315 Ga0395900_0004379
316 Ga0395900_0026031
317 Ga0395900_0034996
318 Ga0395900_0042696
319 Ga0395898_0001285
320 Ga0395898_0028319
321 Ga0395901_0007085
322 Ga0395901_0037167
323 Ga0395901_0054599
324 Ga0395901_0105100
325 Ga0395901_0184455
326 Ga0395901_0236357
327 Ga0436365_1179973
328 Ga0451577_0099028
329 Ga0453684_0276673
330 Ga0451576_0012824
331 Ga0495592_0064998
332 Ga0495650_0000198
333 Ga0495606_0006183
334 Ga0495606_0020878
335 Ga0495616_0001278
336 Ga0495648_0035728
337 Ga0495636_0000008
338 Ga0501032_0071107
339 Ga0501034_0013586
340 Ga0501038_0100588
341 Ga0501043_0008668
342 Ga0501047_0008865
343 Ga0501070_0085646
344 Ga0501073_0002835
345 Ga0501074_0022538
346 Ga0501080_0041986
347 Ga0501083_0100730
348 Ga0501035_0111718
349 Ga0501044_0049407
350 Ga0500644_0000133
351 Ga0500583_0004733
352 Ga0500651_0004228
353 Ga0500569_004412
354 Ga0500607_105088
355 Ga0500658_0007937
356 Ga0500577_0000567
357 Ga0500616_0036231
358 2776612553
359 2852625696
360 2852628285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

154

259

0.9

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

135

251

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ybu-assembly1.cif.gz_A human propionyl-coenzyme a carboxylase 0.9516 67 152
8pn8-assembly1.cif.gz_G engineered glycolyl-coa carboxylase (l100n variant) with bound coa 0.9471 67 149
4qsh-assembly1.cif.gz_C crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.9357 67 152
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.9318 67 152
5ks8-assembly1.cif.gz_C crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.9299 68 153
ID Description Score Start End Superfamily
af_Q91ZA3_659_724_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9633 70 152 2.40.50.100
af_Q553S7_647_713_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9596 68 149 2.40.50.100
af_P71538_589_656_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9592 68 152 2.40.50.100
af_Q9UUE1_1106_1184_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9581 67 152 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9523 68 151 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A1Q6Q3V2-F1-model_v4 Membrane fusion protein biotin-lipoyl like domain-containing protein 0.8442 30 312 GO:0015562
GO:1990281
AF-I0FBR9-F1-model_v4 Membrane fusion protein 0.8237 43 311 GO:0005886
GO:0015562
GO:1990281
AF-A0A0P8WAP5-F1-model_v4 Multidrug resistance protein MdtA 0.8156 40 293 GO:0030313
AF-A0A3E1KA17-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8045 35 312 GO:0015562
GO:1990281
AF-I0FBR9-F1-model_v4 Membrane fusion protein 0.7908 43 311 GO:0005886
GO:0015562
GO:1990281

Map