F274981

General Info

Members Datasets Scaffolds Average Seq Length
180 118 360 199

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100004045|Ga0070690_1000040455
Length 196
Sequence MSGKDYSSATDDALVKAARRGTLDAFEELVARHRDRIYARAVSMMRNEEDAVDLSQEAWVKGWQRLKQFQFESSFSTWMTRIVINLCLDQLRRQKRIRSESIQEMDDEGVAERQLPVVITNPTERLERNELRARIDVALAQLSESHRTVLVLHEFERMEYKEIARAMECSIGTVMSRLFYARRKMASLLAELRRDQ

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 42.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100004045 3300005330 Bacteria 8117
2 Ga0070683_100341350 3300005329 Unclassified 1426
3 Ga0070689_100117175 3300005340 Bacteria 2124
4 Ga0070689_100123954 3300005340 Unclassified 2066
5 Ga0070689_100637113 3300005340 Unclassified 926
6 Ga0070668_100839397 3300005347 Unclassified 818
7 Ga0070669_100894707 3300005353 Unclassified 758
8 Ga0070674_100505052 3300005356 Unclassified 1008
9 Ga0070688_100008584 3300005365 Bacteria 5557
10 Ga0070714_100475272 3300005435 Bacteria 1190
11 Ga0070701_10012965 3300005438 Bacteria 3778
12 Ga0070701_10376609 3300005438 Bacteria 893
13 Ga0070711_100125421 3300005439 Bacteria 1905
14 Ga0070694_100016211 3300005444 Bacteria 4690
15 Ga0068867_100287706 3300005459 Unclassified 1350
16 Ga0070685_10688762 3300005466 Unclassified 744
17 Ga0070707_100805915 3300005468 Unclassified 903
18 Ga0070684_100447250 3300005535 Bacteria 1194
19 Ga0070684_100861396 3300005535 Unclassified 848
20 Ga0070686_100033200 3300005544 Bacteria 3169
21 Ga0070686_100230672 3300005544 Bacteria 1343
22 Ga0070695_100215987 3300005545 Unclassified 1379
23 Ga0070704_100006840 3300005549 Bacteria 6753
24 Ga0068855_100190432 3300005563 Bacteria 2314
25 Ga0070664_100858298 3300005564 Unclassified 850
26 Ga0070702_100146192 3300005615 Bacteria 1512
27 Ga0068859_100084427 3300005617 Bacteria 3221
28 Ga0068859_100135008 3300005617 Bacteria 2540
29 Ga0068859_100210633 3300005617 Bacteria 2030
30 Ga0068859_100244224 3300005617 Bacteria 1885
31 Ga0068859_100471473 3300005617 Bacteria 1351
32 Ga0068859_100595761 3300005617 Unclassified 1199
33 Ga0068863_100028584 3300005841 Bacteria 5323
34 Ga0068863_100288350 3300005841 Bacteria 1591
35 Ga0068863_100628607 3300005841 Unclassified 1064
36 Ga0068858_100101362 3300005842 Bacteria 2685
37 Ga0068862_100323743 3300005844 Unclassified 1424
38 Ga0097621_100806196 3300006237 Unclassified 870
39 Ga0075428_101060826 3300006844 Unclassified 857
40 Ga0075431_100028843 3300006847 Bacteria 5707
41 Ga0075431_100178078 3300006847 Bacteria 2183
42 Ga0075433_10434718 3300006852 Unclassified 1157
43 Ga0075429_100140353 3300006880 Unclassified 2115
44 Ga0075429_100160905 3300006880 Bacteria 1966
45 Ga0068865_100513149 3300006881 Unclassified 1001
46 Ga0097620_100084424 3300006931 Bacteria 3221
47 Ga0097620_100135003 3300006931 Bacteria 2540
48 Ga0097620_100210632 3300006931 Bacteria 2030
49 Ga0097620_100244222 3300006931 Bacteria 1885
50 Ga0097620_100471464 3300006931 Bacteria 1351
51 Ga0097620_100595718 3300006931 Unclassified 1199
52 Ga0099795_10154445 3300007788 Unclassified 942
53 Ga0105240_10044500 3300009093 Bacteria 5640
54 Ga0105240_11341155 3300009093 Unclassified 753
55 Ga0111539_10106967 3300009094 Unclassified 3282
56 Ga0111539_10547072 3300009094 Unclassified 1349
57 Ga0111539_10866603 3300009094 Unclassified 1051
58 Ga0111539_10931187 3300009094 Unclassified 1010
59 Ga0105242_10037427 3300009176 Bacteria 3897
60 Ga0105242_10187088 3300009176 Bacteria 1831
61 Ga0105238_11769585 3300009551 Unclassified 650
62 Ga0157370_10378485 3300013104 Bacteria 1304
63 Ga0157374_10083426 3300013296 Unclassified 3036
64 Ga0157374_10133725 3300013296 Bacteria 2402
65 Ga0157374_10401657 3300013296 Unclassified 1367
66 Ga0157374_11010167 3300013296 Bacteria 851
67 Ga0157378_10648926 3300013297 Unclassified 1071
68 Ga0157378_11218038 3300013297 Unclassified 792
69 Ga0163162_10812235 3300013306 Bacteria 1052
70 Ga0157372_10086817 3300013307 Unclassified 3549
71 Ga0157372_10812270 3300013307 Bacteria 1086
72 Ga0157375_10223481 3300013308 Bacteria 2042
73 Ga0157375_10339360 3300013308 Bacteria 1668
74 Ga0163163_10000086 3300014325 Bacteria 102881
75 Ga0163163_10112261 3300014325 Bacteria 2755
76 Ga0157376_10990959 3300014969 Bacteria 862
77 Ga0206354_11459763 3300020081 Unclassified 1152
78 Ga0207643_10302576 3300025908 Bacteria 995
79 Ga0207695_10104657 3300025913 Bacteria 2818
80 Ga0207693_10406177 3300025915 Unclassified 1065
81 Ga0207663_10248174 3300025916 Bacteria 1309
82 Ga0207646_10598841 3300025922 Unclassified 989
83 Ga0207664_10449636 3300025929 Bacteria 1150
84 Ga0207706_10598383 3300025933 Unclassified 947
85 Ga0207686_10040162 3300025934 Bacteria 2843
86 Ga0207686_10263196 3300025934 Unclassified 1265
87 Ga0207670_10012449 3300025936 Bacteria 4980
88 Ga0207670_10012507 3300025936 Unclassified 4969
89 Ga0207670_10015897 3300025936 Bacteria 4507
90 Ga0207670_10136614 3300025936 Unclassified 1803
91 Ga0207670_10751122 3300025936 Unclassified 810
92 Ga0207665_10188610 3300025939 Bacteria 1497
93 Ga0207667_10155278 3300025949 Bacteria 2355
94 Ga0207668_10538295 3300025972 Unclassified 1010
95 Ga0207703_10103797 3300026035 Bacteria 2414
96 Ga0207641_10019298 3300026088 Bacteria 5595
97 Ga0207641_10885945 3300026088 Bacteria 886
98 Ga0207674_10168661 3300026116 Unclassified 2143
99 Ga0265337_1039355 3300028556 Archaea 1367
100 Ga0265334_10116546 3300028573 Bacteria 957
101 Ga0265332_10013264 3300031238 Bacteria 3655
102 Ga0265329_10001150 3300031242 Bacteria 13010
103 Ga0265327_10003490 3300031251 Bacteria 14951
104 Ga0265316_10127668 3300031344 Bacteria 1917
105 Ga0316575_10026428 3300031665 Bacteria 2256
106 Ga0316579_10301497 3300031691 Unclassified 775
107 Ga0265314_10000517 3300031711 Bacteria 49904
108 Ga0316578_10114551 3300031728 Bacteria 1620
109 Ga0316580_10109920 3300032139 Unclassified 844
110 Ga0373926_0012448 3300035083 Unclassified 2876
111 Ga0373953_0095538 3300035117 Bacteria 1247
112 Ga0373955_0075530 3300035172 Bacteria 1894
113 Ga0316574_0061342 3300035398 Bacteria 2361
114 Ga0373931_0338193 3300035691 Unclassified 939
115 Ga0373935_0386765 3300035692 Unclassified 1002
116 Ga0373933_0506246 3300035724 Unclassified 791
117 Ga0373947_0003295 3300035725 Bacteria 9566
118 Ga0373937_0367313 3300036401 Bacteria 1364
119 Ga0373925_0022985 3300037068 Bacteria 4549
120 Ga0395905_0332427 3300037471 Bacteria 1410
121 Ga0451577_0021573 3300042876 Bacteria 5892
122 Ga0451577_0035860 3300042876 Bacteria 4467
123 Ga0451577_0201954 3300042876 Bacteria 1795
124 Ga0451577_0301435 3300042876 Bacteria 1452
125 Ga0453684_0001125 3300044712 Bacteria 83786
126 Ga0453684_0027100 3300044712 Bacteria 8236
127 Ga0453684_0675468 3300044712 Unclassified 1125
128 Ga0451576_0005808 3300045051 Bacteria 15345
129 Ga0451576_0059810 3300045051 Bacteria 3977
130 Ga0451576_0877203 3300045051 Unclassified 942
131 Ga0451576_0974550 3300045051 Unclassified 889
132 Ga0451576_1027482 3300045051 Bacteria 864
133 Ga0495592_0007277 3300046454 Bacteria 8280
134 Ga0495629_0483587 3300046459 Unclassified 836
135 Ga0495641_0009010 3300046461 Bacteria 5993
136 Ga0495582_0023125 3300046473 Bacteria 3400
137 Ga0495582_0064217 3300046473 Unclassified 2027
138 Ga0495582_0309061 3300046473 Unclassified 909
139 Ga0495639_0113266 3300046475 Unclassified 1289
140 Ga0495639_0211739 3300046475 Unclassified 951
141 Ga0495664_0110005 3300046477 Bacteria 1663
142 Ga0495618_0226210 3300046514 Unclassified 1179
143 Ga0495630_0000453 3300046517 Bacteria 31046
144 Ga0495630_0093707 3300046517 Unclassified 2270
145 Ga0495666_0017778 3300046526 Unclassified 3540
146 Ga0495640_0030414 3300046533 Bacteria 3866
147 Ga0495586_0000305 3300046535 Bacteria 31082
148 Ga0495586_0002009 3300046535 Bacteria 11042
149 Ga0495586_0230059 3300046535 Unclassified 1055
150 Ga0495645_0147613 3300046543 Bacteria 1636
151 Ga0495634_0020770 3300046642 Unclassified 4652
152 Ga0495634_0148566 3300046642 Bacteria 1483
153 Ga0495659_0240012 3300046664 Unclassified 753
154 Ga0495599_0102408 3300046678 Unclassified 1784
155 Ga0495599_0185394 3300046678 Unclassified 1281
156 Ga0495647_0026835 3300046681 Bacteria 2113
157 Ga0495658_0031128 3300046683 Bacteria 2903
158 Ga0495658_0264045 3300046683 Unclassified 1084
159 Ga0495613_0091882 3300046689 Unclassified 2198
160 Ga0495613_0099867 3300046689 Bacteria 2096
161 Ga0495624_0199992 3300046690 Unclassified 1214
162 Ga0495624_0353172 3300046690 Unclassified 884
163 Ga0495581_0084870 3300047315 Unclassified 1835
164 Ga0495674_0004258 3300047319 Bacteria 13782
165 Ga0495674_0032270 3300047319 Bacteria 4751
166 Ga0495676_0006415 3300047321 Bacteria 10838
167 Ga0495676_0094896 3300047321 Unclassified 2221
168 Ga0495684_0161628 3300047471 Unclassified 1670
169 Ga0496115_0007326 3300048918 Bacteria 8116
170 Ga0501033_0251931 3300049570 Unclassified 1251
171 Ga0501034_0186629 3300049571 Bacteria 2037
172 Ga0501070_0801098 3300049586 Unclassified 740
173 Ga0501044_0513911 3300049823 Unclassified 1098
174 nmdc:mga09592_149737_c1 3300050508 Bacteria 2013
175 nmdc:mga06r32_294181_c1 3300050510 Bacteria 1610
176 nmdc:mga06r32_445998_c1 3300050510 Bacteria 1274
177 nmdc:mga06r32_7422_c1 3300050510 Bacteria 9863
178 nmdc:mga08y16_679571_c1 3300050511 Unclassified 1031
179 nmdc:mga08y16_73594_c1 3300050511 Bacteria 3560
180 nmdc:mga0rr50_173488_c1 3300050513 Unclassified 1758
181 Ga0070690_100004045
182 Ga0070683_100341350
183 Ga0070689_100117175
184 Ga0070689_100123954
185 Ga0070689_100637113
186 Ga0070668_100839397
187 Ga0070669_100894707
188 Ga0070674_100505052
189 Ga0070688_100008584
190 Ga0070714_100475272
191 Ga0070701_10012965
192 Ga0070701_10376609
193 Ga0070711_100125421
194 Ga0070694_100016211
195 Ga0068867_100287706
196 Ga0070685_10688762
197 Ga0070707_100805915
198 Ga0070684_100447250
199 Ga0070684_100861396
200 Ga0070686_100033200
201 Ga0070686_100230672
202 Ga0070695_100215987
203 Ga0070704_100006840
204 Ga0068855_100190432
205 Ga0070664_100858298
206 Ga0070702_100146192
207 Ga0068859_100084427
208 Ga0068859_100135008
209 Ga0068859_100210633
210 Ga0068859_100244224
211 Ga0068859_100471473
212 Ga0068859_100595761
213 Ga0068863_100028584
214 Ga0068863_100288350
215 Ga0068863_100628607
216 Ga0068858_100101362
217 Ga0068862_100323743
218 Ga0097621_100806196
219 Ga0075428_101060826
220 Ga0075431_100028843
221 Ga0075431_100178078
222 Ga0075433_10434718
223 Ga0075429_100140353
224 Ga0075429_100160905
225 Ga0068865_100513149
226 Ga0097620_100084424
227 Ga0097620_100135003
228 Ga0097620_100210632
229 Ga0097620_100244222
230 Ga0097620_100471464
231 Ga0097620_100595718
232 Ga0099795_10154445
233 Ga0105240_10044500
234 Ga0105240_11341155
235 Ga0111539_10106967
236 Ga0111539_10547072
237 Ga0111539_10866603
238 Ga0111539_10931187
239 Ga0105242_10037427
240 Ga0105242_10187088
241 Ga0105238_11769585
242 Ga0157370_10378485
243 Ga0157374_10083426
244 Ga0157374_10133725
245 Ga0157374_10401657
246 Ga0157374_11010167
247 Ga0157378_10648926
248 Ga0157378_11218038
249 Ga0163162_10812235
250 Ga0157372_10086817
251 Ga0157372_10812270
252 Ga0157375_10223481
253 Ga0157375_10339360
254 Ga0163163_10000086
255 Ga0163163_10112261
256 Ga0157376_10990959
257 Ga0206354_11459763
258 Ga0207643_10302576
259 Ga0207695_10104657
260 Ga0207693_10406177
261 Ga0207663_10248174
262 Ga0207646_10598841
263 Ga0207664_10449636
264 Ga0207706_10598383
265 Ga0207686_10040162
266 Ga0207686_10263196
267 Ga0207670_10012449
268 Ga0207670_10012507
269 Ga0207670_10015897
270 Ga0207670_10136614
271 Ga0207670_10751122
272 Ga0207665_10188610
273 Ga0207667_10155278
274 Ga0207668_10538295
275 Ga0207703_10103797
276 Ga0207641_10019298
277 Ga0207641_10885945
278 Ga0207674_10168661
279 Ga0265337_1039355
280 Ga0265334_10116546
281 Ga0265332_10013264
282 Ga0265329_10001150
283 Ga0265327_10003490
284 Ga0265316_10127668
285 Ga0316575_10026428
286 Ga0316579_10301497
287 Ga0265314_10000517
288 Ga0316578_10114551
289 Ga0316580_10109920
290 Ga0373926_0012448
291 Ga0373953_0095538
292 Ga0373955_0075530
293 Ga0316574_0061342
294 Ga0373931_0338193
295 Ga0373935_0386765
296 Ga0373933_0506246
297 Ga0373947_0003295
298 Ga0373937_0367313
299 Ga0373925_0022985
300 Ga0395905_0332427
301 Ga0451577_0021573
302 Ga0451577_0035860
303 Ga0451577_0201954
304 Ga0451577_0301435
305 Ga0453684_0001125
306 Ga0453684_0027100
307 Ga0453684_0675468
308 Ga0451576_0005808
309 Ga0451576_0059810
310 Ga0451576_0877203
311 Ga0451576_0974550
312 Ga0451576_1027482
313 Ga0495592_0007277
314 Ga0495629_0483587
315 Ga0495641_0009010
316 Ga0495582_0023125
317 Ga0495582_0064217
318 Ga0495582_0309061
319 Ga0495639_0113266
320 Ga0495639_0211739
321 Ga0495664_0110005
322 Ga0495618_0226210
323 Ga0495630_0000453
324 Ga0495630_0093707
325 Ga0495666_0017778
326 Ga0495640_0030414
327 Ga0495586_0000305
328 Ga0495586_0002009
329 Ga0495586_0230059
330 Ga0495645_0147613
331 Ga0495634_0020770
332 Ga0495634_0148566
333 Ga0495659_0240012
334 Ga0495599_0102408
335 Ga0495599_0185394
336 Ga0495647_0026835
337 Ga0495658_0031128
338 Ga0495658_0264045
339 Ga0495613_0091882
340 Ga0495613_0099867
341 Ga0495624_0199992
342 Ga0495624_0353172
343 Ga0495581_0084870
344 Ga0495674_0004258
345 Ga0495674_0032270
346 Ga0495676_0006415
347 Ga0495676_0094896
348 Ga0495684_0161628
349 Ga0496115_0007326
350 Ga0501033_0251931
351 Ga0501034_0186629
352 Ga0501070_0801098
353 Ga0501044_0513911
354 nmdc:mga09592_149737_c1
355 nmdc:mga06r32_294181_c1
356 nmdc:mga06r32_445998_c1
357 nmdc:mga06r32_7422_c1
358 nmdc:mga08y16_679571_c1
359 nmdc:mga08y16_73594_c1
360 nmdc:mga0rr50_173488_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

138

187

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

132

185

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

29

97

0.96

PF07638

Sigma70_ECF

ECF sigma factor

11

191

0.71

Map